Polyclonal Antibodies And Monoclonal Antibodeies For Elisa
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Antibody Elisa Laboratories manufactures the polyclonal antibodies and monoclonal antibodeies for elisa reagents distributed by Genprice. The Polyclonal Antibodies And Monoclonal Antibodeies For Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact antibody elisa. Other Polyclonal products are available in stock. Specificity: Polyclonal Category: Antibodies Group: And Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 564 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 474 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 495.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 482.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 470.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 472.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC941520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF594 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC941520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF594 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCA1520-250 | Biotium | 250uL | 459.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-100 | Biotium | 100uL | 250.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-500 | Biotium | 500uL | 549.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC041520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC041520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC881520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC881520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC701520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF770 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC701520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF770 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC681520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC681520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCR1520-250 | Biotium | 250uL | 459.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL |
|||
Monoclonal Serum amyloid Antibodies P-Component (N-term), Clone: EP1018Y |
|||
APR13293G | Leading Biology | 0.1ml | 633.6 EUR |
Description: A Monoclonal antibody against Human Serum amyloid Antibodies P-Component (N-term). The antibodies are raised in Rabbit and are from clone EP1018Y. This antibody is applicable in WB and IHC |