Polyclonal Antibodies And Monoclonal Antibodeies For Elisa

Monoclonal antibody for SUR1 and SUR2B

SMC-432D Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Antibody Elisa Laboratories manufactures the polyclonal antibodies and monoclonal antibodeies for elisa reagents distributed by Genprice. The Polyclonal Antibodies And Monoclonal Antibodeies For Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact antibody elisa. Other Polyclonal products are available in stock. Specificity: Polyclonal Category: Antibodies Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 564 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 474 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 495.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 482.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 470.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 472.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

And Monoclonal information

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCP1520-250 Biotium 250uL 459.6 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),PerCP conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCB1520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCB1520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUB1520-100 Biotium 100uL 250.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUB1520-500 Biotium 500uL 549.6 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUM1520-50 Biotium 50uL 474 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC471520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC471520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC431520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF543 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC431520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF543 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC551520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF555 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC551520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF555 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC681520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC681520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL

Monoclonal Serum amyloid Antibodies P-Component (N-term), Clone: EP1018Y

APR13293G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human Serum amyloid Antibodies P-Component (N-term). The antibodies are raised in Rabbit and are from clone EP1018Y. This antibody is applicable in WB and IHC