Polyclonal Antibodies And Monoclonal Antibodeies For Elisa

Anti-Myc and Anti-DDK monoclonal antibodies

E45M08809V-2 EnoGene 50 ul 195 EUR

Antibody Elisa Laboratories manufactures the polyclonal antibodies and monoclonal antibodeies for elisa reagents distributed by Genprice. The Polyclonal Antibodies And Monoclonal Antibodeies For Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact antibody elisa. Other Polyclonal products are available in stock. Specificity: Polyclonal Category: Antibodies Group: And Monoclonal

Monoclonal antibodies for RSV, capture

MyBiosource 2mg 700 EUR

Monoclonal antibodies for RSV, capture

MyBiosource 5mg 1505 EUR

Monoclonal antibodies for RSV, conjugate

MyBiosource 1mg 480 EUR

Monoclonal antibodies for RSV, conjugate

MyBiosource 2mg 700 EUR

Monoclonal antibodies for RSV, conjugate

MyBiosource 5mg 1505 EUR

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 480 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

And Monoclonal information

Monoclonal antibodies for LH (25mIU/ml) capture

MBS596271-5mg MyBiosource 5mg 1505 EUR

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-002mgWithBSAAzideat02mgmL MyBiosource 0.02mg(WithBSA&Azideat0.2mg/mL) 230 EUR

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-01mgWithBSAAzideat02mgmL MyBiosource 0.1mg(WithBSA&Azideat0.2mg/mL) 405 EUR

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-01mgWithoutBSAAzideat1mgmL MyBiosource 0.1mg(WithoutBSA&Azideat1mg/mL) 405 EUR

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-5x01mgWithBSAAzideat02mgmL MyBiosource 5x0.1mg(WithBSA&Azideat0.2mg/mL) 1725 EUR

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-5x01mgWithoutBSAAzideat1mgmL MyBiosource 5x0.1mg(WithoutBSA&Azideat1mg/mL) 1725 EUR

Monoclonal antibodies for LH (25mIU/ml) conjugate

MBS596272-1mg MyBiosource 1mg 480 EUR

Monoclonal antibodies for LH (25mIU/ml) conjugate

MBS596272-2mg MyBiosource 2mg 700 EUR

Monoclonal antibodies for LH (25mIU/ml) conjugate

MBS596272-5mg MyBiosource 5mg 1505 EUR

Anti-Myc and Anti-DDK monoclonal antibodies

E45M08809V-2 EnoGene 50 ul 195 EUR

Anti-Myc and Anti-DDK monoclonal antibodies

TA150014 Origene Technologies GmbH 2 tubes @ 50 ul each Ask for price

Paired monoclonal antibodies for stool S. typhi test

MBS596003-1mg MyBiosource 1mg 360 EUR

Paired monoclonal antibodies for stool S. typhi test

MBS596003-2mg MyBiosource 2mg 550 EUR

Paired monoclonal antibodies for stool S. typhi test

MBS596003-5mg MyBiosource 5mg 1140 EUR

DNA Monoclonal Antibodies

MBS191417-2x01mg MyBiosource 2x0.1mg 310 EUR

Lipase Monoclonal Antibodies

MBS191421-4x01mg MyBiosource 4x0.1mg 570 EUR

Trypsin Monoclonal Antibodies

MBS191422-3x01mg MyBiosource 3x0.1mg 440 EUR