Polyclonal Antibodies And Monoclonal Antibodeies For Elisa

Anti-Myc and Anti-DDK monoclonal antibodies
TA150014 Origene Technologies GmbH 2 tubes @ 50 ul each Ask for price

Antibody Elisa Laboratories manufactures the polyclonal antibodies and monoclonal antibodeies for elisa reagents distributed by Genprice. The Polyclonal Antibodies And Monoclonal Antibodeies For Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact antibody elisa. Other Polyclonal products are available in stock. Specificity: Polyclonal Category: Antibodies Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 564 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 474 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

And Monoclonal information

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL
BNUM1520-50 Biotium 50uL 396 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 0.2mg/mL
BNUB1520-100 Biotium 100uL 225 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 0.2mg/mL
BNUB1520-500 Biotium 500uL 485 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF568 conjugate, 0.1mg/mL
BNC681520-100 Biotium 100uL 192 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF568 conjugate, 0.1mg/mL
BNC681520-500 Biotium 500uL 532 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF647 conjugate, 0.1mg/mL
BNC471520-100 Biotium 100uL 192 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF647 conjugate, 0.1mg/mL
BNC471520-500 Biotium 500uL 532 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF594 conjugate, 0.1mg/mL
BNC941520-100 Biotium 100uL 192 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF594 conjugate, 0.1mg/mL
BNC941520-500 Biotium 500uL 532 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Mfi2 (GFP-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2)
MG210378 Origene Technologies GmbH 10 µg Ask for price

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF488A conjugate, 0.1mg/mL
BNC881520-100 Biotium 100uL 192 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF488A conjugate, 0.1mg/mL
BNC881520-500 Biotium 500uL 532 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF405S conjugate, 0.1mg/mL
BNC041520-100 Biotium 100uL 192 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF405S conjugate, 0.1mg/mL
BNC041520-500 Biotium 500uL 532 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF640R conjugate, 0.1mg/mL
BNC401520-100 Biotium 100uL 192 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), CF640R conjugate, 0.1mg/mL
BNC401520-500 Biotium 500uL 532 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Biotin conjugate, 0.1mg/mL
BNCB1520-100 Biotium 100uL 192 EUR
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application