Polyclonal Antibodies And Monoclonal Antibodeies For Elisa

Anti-Myc and Anti-DDK monoclonal antibodies
TA150014 Origene Technologies GmbH 2 tubes @ 50 ul each Ask for price

Antibody Elisa Laboratories manufactures the polyclonal antibodies and monoclonal antibodeies for elisa reagents distributed by Genprice. The Polyclonal Antibodies And Monoclonal Antibodeies For Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact antibody elisa. Other Polyclonal products are available in stock. Specificity: Polyclonal Category: Antibodies Group: And Monoclonal

Monoclonal antibodies for RSV, capture
MyBiosource 5mg 1505 EUR

Monoclonal antibodies for RSV, conjugate
MyBiosource 1mg 480 EUR

Monoclonal antibodies for RSV, conjugate
MyBiosource 2mg 700 EUR

Monoclonal antibodies for RSV, conjugate
MyBiosource 5mg 1505 EUR

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 480 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

And Monoclonal information

Monoclonal antibodies for LH (25mIU/ml) capture
MBS596271-5mg MyBiosource 5mg 1505 EUR

Negative Control for Rabbit Monoclonal Antibodies
MBS4380418-002mgWithBSAAzideat02mgmL MyBiosource 0.02mg(WithBSA&Azideat0.2mg/mL) 230 EUR

Negative Control for Rabbit Monoclonal Antibodies
MBS4380418-01mgWithBSAAzideat02mgmL MyBiosource 0.1mg(WithBSA&Azideat0.2mg/mL) 405 EUR

Negative Control for Rabbit Monoclonal Antibodies
MBS4380418-01mgWithoutBSAAzideat1mgmL MyBiosource 0.1mg(WithoutBSA&Azideat1mg/mL) 405 EUR

Negative Control for Rabbit Monoclonal Antibodies
MBS4380418-5x01mgWithBSAAzideat02mgmL MyBiosource 5x0.1mg(WithBSA&Azideat0.2mg/mL) 1725 EUR

Negative Control for Rabbit Monoclonal Antibodies
MBS4380418-5x01mgWithoutBSAAzideat1mgmL MyBiosource 5x0.1mg(WithoutBSA&Azideat1mg/mL) 1725 EUR

Monoclonal antibodies for LH (25mIU/ml) conjugate
MBS596272-1mg MyBiosource 1mg 480 EUR

Monoclonal antibodies for LH (25mIU/ml) conjugate
MBS596272-2mg MyBiosource 2mg 700 EUR

Monoclonal antibodies for LH (25mIU/ml) conjugate
MBS596272-5mg MyBiosource 5mg 1505 EUR

Anti-Myc and Anti-DDK monoclonal antibodies
TA150014 Origene Technologies GmbH 2 tubes @ 50 ul each Ask for price

Paired monoclonal antibodies for stool S. typhi test
MBS596003-1mg MyBiosource 1mg 360 EUR

Paired monoclonal antibodies for stool S. typhi test
MBS596003-2mg MyBiosource 2mg 550 EUR

Paired monoclonal antibodies for stool S. typhi test
MBS596003-5mg MyBiosource 5mg 1140 EUR

DNA Monoclonal Antibodies
MBS191417-2x01mg MyBiosource 2x0.1mg 310 EUR

Lipase Monoclonal Antibodies
MBS191421-4x01mg MyBiosource 4x0.1mg 570 EUR

Trypsin Monoclonal Antibodies
MBS191422-3x01mg MyBiosource 3x0.1mg 440 EUR

Amylase Monoclonal Antibodies
MBS191423-3x01mg MyBiosource 3x0.1mg 440 EUR