Influenza Vaccine And Monoclonal Antibodies
Anti-Myc and Anti-DDK monoclonal antibodies |
|||
| TA150014 | Origene Technologies GmbH | 2 tubes @ 50 ul each | Ask for price |
Human IgG antibody Laboratories manufactures the influenza vaccine and monoclonal antibodies reagents distributed by Genprice. The Influenza Vaccine And Monoclonal Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact influenza Antibody. Other Influenza products are available in stock. Specificity: Influenza Category: Vaccine Group: And Monoclonal
Anti-Bovine HMGB1 IgG Antibodies |
||
| Chondrex | 1 mg/ml x 0.1 ml | 406.26 EUR |
|
Description: Anti-Bovine HMGB1 IgG Antibodies |
||
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
| BlueGene | 192 tests | 1524 EUR |
|
Description: A competitive ELISA for quantitative measurement of Human Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
||
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
| BlueGene | 1 plate of 48 wells | 624 EUR |
|
Description: A competitive ELISA for quantitative measurement of Human Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
||
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
| BlueGene | 1 plate of 96 wells | 822 EUR |
|
Description: A competitive ELISA for quantitative measurement of Human Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
||
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
| BlueGene | 96T | 700 EUR |
|
Description: ELISA |
||
Monoclonal PP2A alpha and beta Antibody |
||
| Leading Biology | 0.1ml | 580.8 EUR |
|
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 423.6 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
||
Mouse anti Influenza A Nucleoprotein Monoclonal Antibody |
|||
| DCAB-TJ121 | Creative Diagnostics | 1 mg | 1606.8 EUR |
Mouse anti Influenza A Nucleoprotein Monoclonal Antibody |
|||
| DCAB-TJ122 | Creative Diagnostics | 1 mg | 1606.8 EUR |
Mouse Anti Influenza A Nucleoprotein Monoclonal Antibody |
|||
| DMABT-51396MI | Creative Diagnostics | 1 mg | 982.8 EUR |
Mouse Anti Influenza A Nucleoprotein Monoclonal Antibody |
|||
| DMABT-51397MI | Creative Diagnostics | 0.1 mg | 1070.4 EUR |
Mouse Anti Influenza B Nucleoprotein Monoclonal Antibody |
|||
| DMABT-51408MI | Creative Diagnostics | 1 mg | 1057.2 EUR |
Mouse Anti Influenza B Matrix Protein Monoclonal Antibody |
|||
| DMABT-52177MI | Creative Diagnostics | 0.1 mg | 1070.4 EUR |
Mouse anti Influenza A Hemagglutinin H5 Monoclonal Antibody |
|||
| DCAB-TJ144 | Creative Diagnostics | 0.1 mg | 1762.8 EUR |
Mouse Anti Influenza B Matrix Protein M1 Monoclonal Antibody |
|||
| DMABT-51407MI | Creative Diagnostics | 0.2 mg | 670.8 EUR |
Influenza A (Nucleoprotein) mouse monoclonal antibody, clone F8 |
|||
| 3IN5-F8 | Origene Technologies GmbH | 1 mg | Ask for price |
Influenza A H1N1 mouse monoclonal antibody, clone 9B3.2, Ascites |
|||
| AM05798SU-N | Origene Technologies GmbH | 100 µl | Ask for price |
Influenza B mouse monoclonal antibody, clone BGN/5G8, Purified |
|||
| BM1179 | Origene Technologies GmbH | 200 µg | Ask for price |
Influenza A H1N1 mouse monoclonal antibody, clone 5C1, Purified |
|||
| AM32419PU-N | Origene Technologies GmbH | 100 µg | Ask for price |
Mouse anti Influenza B virus Nucleoprotein Monoclonal Antibody |
|||
| DCAB-TJ115 | Creative Diagnostics | 1 mg | 1606.8 EUR |
Influenza A (Haemagglutinin) mouse monoclonal antibody, clone 1B4 |
|||
| 3H5N-1B4 | Origene Technologies GmbH | 1 mg | Ask for price |
Influenza A (Haemagglutinin) mouse monoclonal antibody, clone 1C7 |
|||
| 3H5N-1C7 | Origene Technologies GmbH | 1 mg | Ask for price |
Influenza B (Nucleoprotein) mouse monoclonal antibody, clone InB12 |
|||
| 3IF18-InB12 | Origene Technologies GmbH | 1 mg | Ask for price |
Influenza B (Nucleoprotein) mouse monoclonal antibody, clone InB27 |
|||
| 3IF18-InB27 | Origene Technologies GmbH | 1 mg | Ask for price |