Igm Monoclonal And Nervous System Disorders

Mouse Anti Human Macrophage (Tissue And Proliferative Disorders) Monoclonal Antibody

DMABT-52185MH Creative Diagnostics 0.5 ml 1226.4 EUR

Human IgG antibody Laboratories manufactures the igm monoclonal and nervous system disorders reagents distributed by Genprice. The Igm Monoclonal And Nervous System Disorders reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igm monoclonal. Other Igm products are available in stock. Specificity: Igm Category: Monoclonal Group: And Nervous

Neural Dissociation System 2 (Neurons, Neurons and glial,Retina), Mouse and Rat

CHI Scientific ea Ask for price

Monoclonal PP2A alpha and beta Antibody

Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 480 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

And Nervous information

Mouse Anti Sheep Igm Monoclonal Antibody

DMABT-51994MS Creative Diagnostics 0.25 mg 889.2 EUR

Mouse Anti Sheep Igm Monoclonal Antibody

DMABT-51995MS Creative Diagnostics 2 ml 889.2 EUR

Mouse Anti Bovine Igm Monoclonal Antibody

DMABT-51911MB Creative Diagnostics 0.25 mg 889.2 EUR

Mouse Anti Chicken Igm Monoclonal Antibody

DMABT-51959MC Creative Diagnostics 0.25 mg 889.2 EUR

Monoclonal Mouse Anti-Pig IgM(u)

C010216-10mg Unibiotest 10mg 1134 EUR

Monoclonal Mouse Anti-Pig IgM(u)

C010216-1mg Unibiotest 1mg 272.4 EUR

Monoclonal Mouse Anti-Dog IgM(u)

C010218-10mg Unibiotest 10mg 1134 EUR

Monoclonal Mouse Anti-Dog IgM(u)

C010218-1mg Unibiotest 1mg 272.4 EUR

HRP*Monoclonal Mouse Anti- Human IgM

C030201-10ml Unibiotest 10ml 2148 EUR

HRP*Monoclonal Mouse Anti- Human IgM

C030201-1ml Unibiotest 1ml 424.8 EUR

Monoclonal Mouse Anti-Human IgM(u)

C010204-10mg Unibiotest 10mg 830.4 EUR

Monoclonal Mouse Anti-Human IgM(u)

C010204-1mg Unibiotest 1mg 222 EUR

FITC*Monoclonal Mouse Anti- Human IgM

C030601-10ml Unibiotest 10ml 2148 EUR

FITC*Monoclonal Mouse Anti- Human IgM

C030601-1ml Unibiotest 1ml 424.8 EUR

Immunoglobulin M (IgM) Monoclonal Antibody (Mouse)

4-MAA543Mu21 Cloud-Clone
  • 280.80 EUR
  • 2774.40 EUR
  • 696.00 EUR
  • 350.40 EUR
  • 249.60 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rat monoclonal antibody against Mouse Immunoglobulin M (IgM)

Immunoglobulin M (IgM) Monoclonal Antibody (Mouse)

4-MAA543Mu29 Cloud-Clone
  • 306.00 EUR
  • 3170.40 EUR
  • 786.00 EUR
  • 386.40 EUR
  • 260.40 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rat monoclonal antibody against Mouse Immunoglobulin M (IgM)

Monoclonal Mouse Anti-Chicken IgM(u)

C010217-10mg Unibiotest 10mg 1134 EUR