Igm Monoclonal And Nervous System Disorders
Mouse Anti Human Macrophage (Tissue And Proliferative Disorders) Monoclonal Antibody |
|||
DMABT-52185MH | Creative Diagnostics | 0.5 ml | 1226.4 EUR |
Human IgG antibody Laboratories manufactures the igm monoclonal and nervous system disorders reagents distributed by Genprice. The Igm Monoclonal And Nervous System Disorders reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igm monoclonal. Other Igm products are available in stock. Specificity: Igm Category: Monoclonal Group: And Nervous
Neural Dissociation System 2 (Neurons, Neurons and glial,Retina), Mouse and Rat |
||
CHI Scientific | ea | Ask for price |
Monoclonal PP2A alpha and beta Antibody |
||
Leading Biology | 0.1ml | 580.8 EUR |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 480 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Mouse Anti Sheep Igm Monoclonal Antibody |
|||
DMABT-51994MS | Creative Diagnostics | 0.25 mg | 889.2 EUR |
Mouse Anti Sheep Igm Monoclonal Antibody |
|||
DMABT-51995MS | Creative Diagnostics | 2 ml | 889.2 EUR |
Mouse Anti Bovine Igm Monoclonal Antibody |
|||
DMABT-51911MB | Creative Diagnostics | 0.25 mg | 889.2 EUR |
Mouse Anti Chicken Igm Monoclonal Antibody |
|||
DMABT-51959MC | Creative Diagnostics | 0.25 mg | 889.2 EUR |
Monoclonal Mouse Anti-Pig IgM(u) |
|||
C010216-10mg | Unibiotest | 10mg | 1134 EUR |
Monoclonal Mouse Anti-Pig IgM(u) |
|||
C010216-1mg | Unibiotest | 1mg | 272.4 EUR |
Monoclonal Mouse Anti-Dog IgM(u) |
|||
C010218-10mg | Unibiotest | 10mg | 1134 EUR |
Monoclonal Mouse Anti-Dog IgM(u) |
|||
C010218-1mg | Unibiotest | 1mg | 272.4 EUR |
HRP*Monoclonal Mouse Anti- Human IgM |
|||
C030201-10ml | Unibiotest | 10ml | 2148 EUR |
HRP*Monoclonal Mouse Anti- Human IgM |
|||
C030201-1ml | Unibiotest | 1ml | 424.8 EUR |
Monoclonal Mouse Anti-Human IgM(u) |
|||
C010204-10mg | Unibiotest | 10mg | 830.4 EUR |
Monoclonal Mouse Anti-Human IgM(u) |
|||
C010204-1mg | Unibiotest | 1mg | 222 EUR |
FITC*Monoclonal Mouse Anti- Human IgM |
|||
C030601-10ml | Unibiotest | 10ml | 2148 EUR |
FITC*Monoclonal Mouse Anti- Human IgM |
|||
C030601-1ml | Unibiotest | 1ml | 424.8 EUR |
Immunoglobulin M (IgM) Monoclonal Antibody (Mouse) |
|||
4-MAA543Mu21 | Cloud-Clone |
|
|
Description: A Rat monoclonal antibody against Mouse Immunoglobulin M (IgM) |
|||
Immunoglobulin M (IgM) Monoclonal Antibody (Mouse) |
|||
4-MAA543Mu29 | Cloud-Clone |
|
|
Description: A Rat monoclonal antibody against Mouse Immunoglobulin M (IgM) |
|||
Monoclonal Mouse Anti-Chicken IgM(u) |
|||
C010217-10mg | Unibiotest | 10mg | 1134 EUR |