Monoclonal Antibody And Viralreactivatio

Human Anti centriole and centrosome antibody IgG ELISA kit
E01A0306 BlueGene 96T 700 EUR
Description: ELISA

Human IgG antibody Laboratories manufactures the monoclonal antibody and viralreactivatio reagents distributed by Genprice. The Monoclonal Antibody And Viralreactivatio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact viral monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: And Viralreactivatio

Goat Anti centriole and centrosome antibody IgG ELISA kit
BlueGene 96T 700 EUR
Description: ELISA

Porcine Anti centriole and centrosome antibody IgG ELISA kit
BlueGene 96T 700 EUR
Description: ELISA

Canine Anti centriole and centrosome antibody IgG ELISA kit
BlueGene 96T 700 EUR
Description: ELISA

Rabbit Anti centriole and centrosome antibody IgG ELISA kit
BlueGene 96T 700 EUR
Description: ELISA

Rabbit Anti centriole and centrosome antibody IgG ELISA kit
BlueGene 192 tests 1524 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Anti centriole and centrosome antibody IgG ELISA kit
BlueGene 1 plate of 48 wells 624 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Anti centriole and centrosome antibody IgG ELISA kit
BlueGene 1 plate of 96 wells 822 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

And Viralreactivatio information

Monoclonal antibody for SUR1 and SUR2B
SMC-432D-RPE Stressmarq 0.1mg 475.2 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B
SMC-432D-STR Stressmarq 0.1mg 476.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B
SMC-432S Stressmarq 0.012mg 78 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA) Monoclonal Antibody
CAU30845-100ul Biomatik Corporation 100ul 281.3 EUR

V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA) Monoclonal Antibody
CAU30845-200ul Biomatik Corporation 200ul 351.1 EUR

Mouse Anti-Epstein Barr Virus Viral Capsid Antigen gp125 Monoclonal Antibody
DMAB3334 Creative Diagnostics 1 mg 1083.6 EUR

Monoclonal PP2A alpha and beta Antibody
AMM03147G Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Mouse Monoclonal Anti-SUR1 and SUR2B Antibody
TA326509 Origene Technologies GmbH 100 µg Ask for price

Monoclonal Antibody to Coxsackie Virus And Adenovirus Receptor (CXADR)
MAJ305Hu21 Cloud-Clone 100ul 259 EUR

Monoclonal Anti-Spectrin(alpha and beta) Antibody Antibody
GWB-BBB082 GenWay Biotech 0.1 mg Ask for price

Mouse Monoclonal Antibody to P16 (Mouse and Human)
E10-20129 EnoGene 100ul 225 EUR
Description: Available in various conjugation types.

Mouse Monoclonal Antibody to P16 (Mouse and Human)
E10-20130 EnoGene 100ul 225 EUR
Description: Available in various conjugation types.

Mouse Monoclonal Antibody to P16 (Mouse and Human)
sAP-0102 Angio Proteomie 50ug 270 EUR

Mouse Monoclonal Antibody to P16 (Mouse and Human)
sAP-0103 Angio Proteomie 50ug 270 EUR

Monoclonal Antibody to Phosphatase And Tensin Homolog (PTEN)
MAF822Hu21 Cloud-Clone 100ul 259 EUR

Monoclonal Antibody to Phosphatase And Tensin Homolog (PTEN)
MAF822Hu22 Cloud-Clone 100ul 266 EUR

Monoclonal Antibody to Phosphatase And Tensin Homolog (PTEN)
MAF822Hu23 Cloud-Clone 100ul 266 EUR