Rat Hybridomas And Rat Monoclonal
Lab Reagents
Human IgG antibody Laboratories manufactures the rat hybridomas and rat monoclonal reagents distributed by Genprice. The Rat Hybridomas And Rat Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rat monoclonal. Other Rat products are available in stock. Specificity: Rat Category: Hybridomas Group: And Rat
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-A700 | Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-ALP | Stressmarq | 0.1mg | 471.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-APC | Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-APCCY7 | Stressmarq | 0.1mg | 564 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-BI | Stressmarq | 0.1mg | 474 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY350 | Stressmarq | 0.1mg | 495.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY405 | Stressmarq | 0.1mg | 482.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY488 | Stressmarq | 0.1mg | 470.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY594 | Stressmarq | 0.1mg | 472.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY633 | Stressmarq | 0.1mg | 466.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-FITC | Stressmarq | 0.1mg | 469.2 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with FITC. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-HRP | Stressmarq | 0.1mg | 464.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-P594 | Stressmarq | 0.1mg | 487.2 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-PCP | Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-RPE | Stressmarq | 0.1mg | 475.2 EUR |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-STR | Stressmarq | 0.1mg | 476.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432S | Stressmarq | 0.012mg | 78 EUR |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |