Rat Hybridomas And Rat Monoclonal

Rat Anti Human Macrophages And Neutrophils Monoclonal Antibody

DMABT-49599RH Creative Diagnostics 200 TEST 920.4 EUR

Human IgG antibody Laboratories manufactures the rat hybridomas and rat monoclonal reagents distributed by Genprice. The Rat Hybridomas And Rat Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rat monoclonal. Other Rat products are available in stock. Specificity: Rat Category: Hybridomas Group: And Rat

Monoclonal PP2A alpha and beta Antibody

Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 480 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

And Rat information

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC881270-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF488A conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC881270-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF488A conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC051270-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF405M conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC051270-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF405M conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC041270-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF405S conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC041270-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF405S conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC401270-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF640R conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNC401270-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), CF640R conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCB1270-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), Biotin conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCB1270-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), Biotin conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCAP1270-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCAP1270-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCA1270-250 Biotium 250uL 459.6 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), APC conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCR1270-250 Biotium 250uL 459.6 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), RPE conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCP1270-250 Biotium 250uL 459.6 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), PerCP conjugate, Concentration: 0.1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNUM1270-50 Biotium 50uL 474 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), 1mg/mL

IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) (IL6/1270) Antibody

BNCH1270-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against IL-6 (Interleukin-6) / Interferon beta-2 (Hybridoma Growth Factor) ( IL6/1270), Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL