Monoclonal Antibody And Viralreactivatio
Human Centriole and Centrosome Antibody IgG ELISA Kit |
|||
| MBS039049-10x96StripWells | MyBiosource | 10x96-Strip-Wells | 6725 EUR |
Human IgG antibody Laboratories manufactures the monoclonal antibody and viralreactivatio reagents distributed by Genprice. The Monoclonal Antibody And Viralreactivatio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact viral monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: And Viralreactivatio
Goat Anti-Human IgG Heavy and Light Chain Antibody |
||
| MyBiosource | 1mg | 240 EUR |
Goat Anti-Human IgG Heavy and Light Chain Antibody |
||
| MyBiosource | 5x1mg | 1065 EUR |
Human Anti centriole and centrosome antibody IgG ELISA Kit |
||
| MyBiosource | 10x96-Strip-Wells | 5685 EUR |
Human Anti centriole and centrosome antibody IgG ELISA Kit |
||
| MyBiosource | 48-Strip-Wells | 485 EUR |
Human Anti centriole and centrosome antibody IgG ELISA Kit |
||
| MyBiosource | 5x96-Strip-Wells | 3020 EUR |
Human Anti centriole and centrosome antibody IgG ELISA Kit |
||
| MyBiosource | 96-Strip-Wells | 690 EUR |
Plant Centriole and Centrosome Antibody IgG (CC-IgG) ELISA Kit |
||
| MyBiosource | INQUIRE | Ask for price |
And Viralreactivatio information
Monoclonal antibody for SUR1 and SUR2B |
|||
| SMC-432D-RPE | Stressmarq | 0.1mg | 475.2 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
| SMC-432D-STR | Stressmarq | 0.1mg | 476.4 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin. |
|||
Monoclonal antibody for SUR1 and SUR2B |
|||
| SMC-432S | Stressmarq | 0.012mg | 78 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
|||
V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA) Monoclonal Antibody |
|||
| CAU30845-100ul | Biomatik Corporation | 100ul | 281.3 EUR |
V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA) Monoclonal Antibody |
|||
| CAU30845-200ul | Biomatik Corporation | 200ul | 351.1 EUR |
Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA) |
|||
| MBS2139392-INQUIRE | MyBiosource | INQUIRE | Ask for price |
Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA) |
|||
| MBS2139393-INQUIRE | MyBiosource | INQUIRE | Ask for price |
Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA) |
|||
| MBS2139394-INQUIRE | MyBiosource | INQUIRE | Ask for price |
Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA) |
|||
| MBS2139395-INQUIRE | MyBiosource | INQUIRE | Ask for price |
Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA) |
|||
| MBS2139396-INQUIRE | MyBiosource | INQUIRE | Ask for price |
Mouse Anti-Epstein Barr Virus Viral Capsid Antigen gp125 Monoclonal Antibody |
|||
| DMAB3334 | Creative Diagnostics | 1 mg | 677.04 EUR |
|
Description: Mouse |
|||
Monoclonal Antibody to V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA) |
|||
| MBS2111712-INQUIRE | MyBiosource | INQUIRE | Ask for price |
Monoclonal PP2A alpha and beta Antibody |
|||
| AMM03147G | Leading Biology | 0.1ml | 580.8 EUR |
|
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
|||
Caspase-3 (Pro and Active) Monoclonal Antibody |
|||
| MBS668032-0025mg | MyBiosource | 0.025mg | 185 EUR |
Caspase-3 (Pro and Active) Monoclonal Antibody |
|||
| MBS668032-01mg | MyBiosource | 0.1mg | 350 EUR |
Caspase-3 (Pro and Active) Monoclonal Antibody |
|||
| MBS668032-5x01mg | MyBiosource | 5x0.1mg | 1570 EUR |
Mouse Monoclonal Anti-SUR1 and SUR2B Antibody |
|||
| TA326509 | Origene Technologies GmbH | 100 µg | Ask for price |
