Monoclonal Antibody And Viralreactivatio
Lab Reagents
Human IgG antibody Laboratories manufactures the monoclonal antibody and viralreactivatio reagents distributed by Genprice. The Monoclonal Antibody And Viralreactivatio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact viral monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: And Viralreactivatio
And Viralreactivatio information
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-APC | Stressmarq | 0.1mg | EUR 398 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-APCCY7 | Stressmarq | 0.1mg | EUR 470 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-BI | Stressmarq | 0.1mg | EUR 395 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY350 | Stressmarq | 0.1mg | EUR 413 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY405 | Stressmarq | 0.1mg | EUR 402 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY488 | Stressmarq | 0.1mg | EUR 392 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY594 | Stressmarq | 0.1mg | EUR 394 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY633 | Stressmarq | 0.1mg | EUR 389 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-FITC | Stressmarq | 0.1mg | EUR 391 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with FITC. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-HRP | Stressmarq | 0.1mg | EUR 387 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-P594 | Stressmarq | 0.1mg | EUR 406 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-PCP | Stressmarq | 0.1mg | EUR 398 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-RPE | Stressmarq | 0.1mg | EUR 396 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-STR | Stressmarq | 0.1mg | EUR 397 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432S | Stressmarq | 0.012mg | EUR 65 |
|
|||
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Rat Anti Human Macrophages And Neutrophils Monoclonal Antibody |
|||
DMABT-49599RH | Creative Diagnostics | 200 TEST | EUR 767 |
Monoclonal P16 (Mouse and Human) Antibody, Clone: 1E12E10 |
|||
AMM02637G | Leading Biology | 0.1ml | EUR 528 |
Description: A Monoclonal antibody against Human P16 (Mouse and Human). The antibodies are raised in Mouse and are from clone 1E12E10. This antibody is applicable in WB and IHC, E |