Monoclonal Antibody And Viralreactivatio

Lab Reagents

Human IgG antibody Laboratories manufactures the monoclonal antibody and viralreactivatio reagents distributed by Genprice. The Monoclonal Antibody And Viralreactivatio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact viral monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: And Viralreactivatio

And Viralreactivatio information

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-PCP Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE Stressmarq 0.1mg 475.2 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR Stressmarq 0.1mg 476.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S Stressmarq 0.012mg 78 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal P16 (Mouse and Human) Antibody, Clone: 1E12E10

AMM02637G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human P16 (Mouse and Human). The antibodies are raised in Mouse and are from clone 1E12E10. This antibody is applicable in WB and IHC, E

Rat Anti Human Macrophages And Neutrophils Monoclonal Antibody

DMABT-49599RH Creative Diagnostics 200 TEST 920.4 EUR

Anti-S100B (Astrocyte and Melanoma Marker) Monoclonal Antibody

M00979 BosterBio 100ug/vial 476.4 EUR
Description: Mouse Monoclonal S100B (Astrocyte and Melanoma Marker) Antibody. Validated in IHC and tested in Bovine, Human, Rabbit, Rat.

Monoclonal CD28 Antibody - With BSA and Azide, Clone: CB28

APR14440G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human CD28 - With BSA and Azide. The antibodies are raised in Mouse and are from clone CB28. This antibody is applicable in IHC, IF, FC, IP, E

Monoclonal CD6 Antibody - With BSA and Azide, Clone: 3F7B5

APR14460G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human CD6 - With BSA and Azide. The antibodies are raised in Mouse and are from clone 3F7B5. This antibody is applicable in IHC

Monoclonal Moesin Antibody - With BSA and Azide, Clone: SPM562

APR14681G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human Moesin - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM562. This antibody is applicable in IHC-P, IF, FC

Monoclonal Moesin Antibody - Without BSA and Azide, Clone: SPM562

APR14684G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human Moesin - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM562. This antibody is applicable in IHC-P, IF, FC

Monoclonal Fibronectin Antibody - With BSA and Azide, Clone: SPM539

AMM00268G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human Fibronectin - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM539. This antibody is applicable in IHC-P, IF, FC

Monoclonal Fibronectin Antibody - Without BSA and Azide, Clone: SPM539

AMM00269G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human Fibronectin - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM539. This antibody is applicable in IHC-P, IF, FC

Monoclonal Fibronectin Antibody - With BSA and Azide, Clone: SPM246

AMM00271G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human Fibronectin - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM246. This antibody is applicable in IHC-P, IF, FC

Monoclonal Fibronectin Antibody - Without BSA and Azide, Clone: SPM246

AMM00272G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human Fibronectin - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM246. This antibody is applicable in IHC-P, IF, FC

Monoclonal CD6 Antibody - Without BSA and Azide, Clone: 3F7B5

AMM00453G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human CD6 - Without BSA and Azide. The antibodies are raised in Mouse and are from clone 3F7B5. This antibody is applicable in IHC-P, IF, FC

Monoclonal CD6 Antibody - With BSA and Azide, Clone: SPM547

AMM00455G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human CD6 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM547. This antibody is applicable in IHC-P, IF, FC