Monoclonal Antibody And Viralreactivatio

Human Centriole and Centrosome Antibody IgG ELISA Kit

MBS039049-10x96StripWells MyBiosource 10x96-Strip-Wells 6725 EUR

Human IgG antibody Laboratories manufactures the monoclonal antibody and viralreactivatio reagents distributed by Genprice. The Monoclonal Antibody And Viralreactivatio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact viral monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: And Viralreactivatio

Goat Anti-Human IgG Heavy and Light Chain Antibody

MyBiosource 1mg 240 EUR

Goat Anti-Human IgG Heavy and Light Chain Antibody

MyBiosource 5x1mg 1065 EUR

Human Anti centriole and centrosome antibody IgG ELISA Kit

MyBiosource 10x96-Strip-Wells 5685 EUR

Human Anti centriole and centrosome antibody IgG ELISA Kit

MyBiosource 48-Strip-Wells 485 EUR

Human Anti centriole and centrosome antibody IgG ELISA Kit

MyBiosource 5x96-Strip-Wells 3020 EUR

Human Anti centriole and centrosome antibody IgG ELISA Kit

MyBiosource 96-Strip-Wells 690 EUR

Plant Centriole and Centrosome Antibody IgG (CC-IgG) ELISA Kit

MyBiosource INQUIRE Ask for price

And Viralreactivatio information

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE Stressmarq 0.1mg 475.2 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR Stressmarq 0.1mg 476.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S Stressmarq 0.012mg 78 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA) Monoclonal Antibody

CAU30845-100ul Biomatik Corporation 100ul 281.3 EUR

V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA) Monoclonal Antibody

CAU30845-200ul Biomatik Corporation 200ul 351.1 EUR

Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA)

MBS2139392-INQUIRE MyBiosource INQUIRE Ask for price

Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA)

MBS2139393-INQUIRE MyBiosource INQUIRE Ask for price

Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA)

MBS2139394-INQUIRE MyBiosource INQUIRE Ask for price

Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA)

MBS2139395-INQUIRE MyBiosource INQUIRE Ask for price

Monoclonal Antibody to VRal Simian Leukemia Viral Oncogene Homolog A (RALA)

MBS2139396-INQUIRE MyBiosource INQUIRE Ask for price

Mouse Anti-Epstein Barr Virus Viral Capsid Antigen gp125 Monoclonal Antibody

DMAB3334 Creative Diagnostics 1 mg 677.04 EUR
Description: Mouse

Monoclonal Antibody to V-Ral Simian Leukemia Viral Oncogene Homolog A (RALA)

MBS2111712-INQUIRE MyBiosource INQUIRE Ask for price

Monoclonal PP2A alpha and beta Antibody

AMM03147G Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Caspase-3 (Pro and Active) Monoclonal Antibody

MBS668032-0025mg MyBiosource 0.025mg 185 EUR

Caspase-3 (Pro and Active) Monoclonal Antibody

MBS668032-01mg MyBiosource 0.1mg 350 EUR

Caspase-3 (Pro and Active) Monoclonal Antibody

MBS668032-5x01mg MyBiosource 5x0.1mg 1570 EUR

Mouse Monoclonal Anti-SUR1 and SUR2B Antibody

TA326509 Origene Technologies GmbH 100 µg Ask for price