Monoclonal Antibody And Viralreactivatio

Lab Reagents

Human IgG antibody Laboratories manufactures the monoclonal antibody and viralreactivatio reagents distributed by Genprice. The Monoclonal Antibody And Viralreactivatio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact viral monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: And Viralreactivatio

And Viralreactivatio information

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE 0.1mg
EUR 396
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR 0.1mg
EUR 397
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S 0.012mg
EUR 65
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 484
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Anti-S100B (Astrocyte and Melanoma Marker) Monoclonal Antibody

M00979 100ug/vial
EUR 397
Description: Mouse Monoclonal S100B (Astrocyte and Melanoma Marker) Antibody. Validated in IHC and tested in Bovine, Human, Rabbit, Rat.

Rat Anti Human Macrophages And Neutrophils Monoclonal Antibody

DMABT-49599RH 200 TEST
EUR 767

Monoclonal P16 (Mouse and Human) Antibody, Clone: 1E12E10

AMM02637G 0.1ml
EUR 528
Description: A Monoclonal antibody against Human P16 (Mouse and Human). The antibodies are raised in Mouse and are from clone 1E12E10. This antibody is applicable in WB and IHC, E

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human)

4-MAB555Hu22
  • EUR 221.00
  • EUR 2114.00
  • EUR 535.00
  • EUR 274.00
  • EUR 203.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17)

Cocaine And Amphetamine Regulated Transcript (CART) Monoclonal Antibody (Rat)

4-MAA352Ra21
  • EUR 251.00
  • EUR 2582.00
  • EUR 641.00
  • EUR 316.00
  • EUR 215.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Rat Cocaine And Amphetamine Regulated Transcript (CART)

Anti-Spectrin(alpha and beta) Antibody (monoclonal, SB-SP1)

MA1090 100ug/vial
EUR 294

Mouse Anti Rat Granulocytes And Erythroid Cells Monoclonal Antibody

DMABT-49809MR 2 ml
EUR 881

Monoclonal CD28 Antibody - With BSA and Azide, Clone: CB28

APR14440G 0.05mg
EUR 396
Description: A Monoclonal antibody against Human CD28 - With BSA and Azide. The antibodies are raised in Mouse and are from clone CB28. This antibody is applicable in IHC, IF, FC, IP, E

Monoclonal CD6 Antibody - With BSA and Azide, Clone: 3F7B5

APR14460G 0.05mg
EUR 396
Description: A Monoclonal antibody against Human CD6 - With BSA and Azide. The antibodies are raised in Mouse and are from clone 3F7B5. This antibody is applicable in IHC

Monoclonal Fibronectin Antibody - With BSA and Azide, Clone: SPM539

AMM00268G 0.05mg
EUR 396
Description: A Monoclonal antibody against Human Fibronectin - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM539. This antibody is applicable in IHC-P, IF, FC

Monoclonal Fibronectin Antibody - Without BSA and Azide, Clone: SPM539

AMM00269G 0.1mg
EUR 484
Description: A Monoclonal antibody against Human Fibronectin - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM539. This antibody is applicable in IHC-P, IF, FC

Monoclonal Fibronectin Antibody - With BSA and Azide, Clone: SPM246

AMM00271G 0.05mg
EUR 396
Description: A Monoclonal antibody against Human Fibronectin - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM246. This antibody is applicable in IHC-P, IF, FC

Monoclonal Fibronectin Antibody - Without BSA and Azide, Clone: SPM246

AMM00272G 0.1mg
EUR 484
Description: A Monoclonal antibody against Human Fibronectin - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM246. This antibody is applicable in IHC-P, IF, FC