Monoclonal Antibodies And Bacteria

Cattle and Goat Tuberculosis Antibodies Rapid Test Kit (Colloidal gold)

abx092019-40tests Abbexa 40 tests 585.6 EUR

Bacteria Monoclonal Laboratories manufactures the monoclonal antibodies and bacteria reagents distributed by Genprice. The Monoclonal Antibodies And Bacteria reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact bacteria monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibodies Group: And Bacteria

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 564 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

And Bacteria information

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCAP1520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCAP1520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCA1520-250 Biotium 250uL 459.6 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCR1520-250 Biotium 250uL 459.6 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCH1520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCH1520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCP1520-250 Biotium 250uL 459.6 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),PerCP conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCB1520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCB1520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUB1520-100 Biotium 100uL 250.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUB1520-500 Biotium 500uL 549.6 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUM1520-50 Biotium 50uL 474 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC471520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC471520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-500 Biotium 500uL 652.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC431520-100 Biotium 100uL 238.8 EUR
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF543 conjugate, Concentration: 0.1mg/mL