Low Iga And Igm High Igg And Monocolonal
Human IgA, IgG and IgM AssayLite Multiplex Fluorescent Immunoassay Kit |
|||
FI700161M3 | AssayPro | 96 Well Plate | 1472.4 EUR |
Iga Monoclonal Laboratories manufactures the low iga and igm high igg and monocolonal reagents distributed by Genprice. The Low Iga And Igm High Igg And Monocolonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Low products are available in stock. Specificity: Low Category: Iga Group: And Igm
p5 Ligand for Dnak and and DnaJ |
||
CHI Scientific | 4 x 5mg | Ask for price |
Linsmaier and Skoog, With macro- and micronutrients |
||
GenDepot | 10X1L | 121.2 EUR |
Linsmaier and Skoog, With macro- and micronutrients |
||
GenDepot | 50L | 151.2 EUR |
Murashige and Skoog, With Vitamins and Glycine |
||
GenDepot | 10X1L | 118.8 EUR |
Murashige and Skoog, With Vitamins and Glycine |
||
GenDepot | 50L | 151.2 EUR |
Monoclonal PP2A alpha and beta Antibody |
||
Leading Biology | 0.1ml | 580.8 EUR |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Goat anti Human IgG + IgA + IgM (rhodamine) |
|||
43R-1249 | Fitzgerald | 1 mg | 178.8 EUR |
Description: Goat anti Human IgG + IgA + IgM secondary antibody (rhodamine) |
|||
Goat anti Human IgG + IgA + IgM (rhodamine) |
|||
43R-1255 | Fitzgerald | 500 ug | 223.2 EUR |
Description: Goat anti Human IgG + IgA + IgM secondary antibody (rhodamine) |
|||
Goat Anti-Human IgG+IgM+IgA Antibody |
|||
20-abx134792 | Abbexa |
|
|
Rabbit Anti-Human IgG+IgM+IgA Antibody |
|||
20-abx134797 | Abbexa |
|
|
Treponema Pallidum IgA, IgG, IgM ELISA Kit |
|||
E4675-100 | Biovision | each | 646.8 EUR |
Mouse IgA, IgGs (1, 2a, 2b, 3), IgM, and IgE isotype controls (set of 7 IgGs) |
|||
20102-SET | Alpha Diagnostics | 1 Set (100 ugx7) | 717.6 EUR |
Goat anti Monkey IgG + IgA + IgM (H + L) (HRP) |
|||
43C-CB1617 | Fitzgerald | 1 mg | 525.6 EUR |
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (HRP) |
|||
Goat anti Monkey IgG + IgA + IgM (H + L) (HRP) |
|||
43R-IG050hrp | Fitzgerald | 1 mg | 495.6 EUR |
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (HRP) |
|||
Goat anti Monkey IgG + IgA + IgM (H + L) (FITC) |
|||
43C-CB1613 | Fitzgerald | 1 mg | 430.8 EUR |
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (FITC) |
|||
Goat anti Rat IgG + IgA + IgM (H + L) |
|||
41C-CB1257 | Fitzgerald | 2 mg | 342 EUR |
Description: Goat anti Rat IgG + IgA + IgM (H + L) secondary antibody |
|||
Goat anti Monkey IgG + IgA + IgM (H + L) (biotin) |
|||
43C-CB1616 | Fitzgerald | 1 mg | 442.8 EUR |
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (biotin) |
|||
Goat anti Human IgG + IgA + IgM (H + L) |
|||
40C-CB0986 | Fitzgerald | 2 mg | 320.4 EUR |
Description: Goat anti Human IgG + IgA + IgM (H + L) secondary antibody |
|||
Goat anti Mouse IgG+IgA+IgM (H + L) |
|||
41C-CB1599 | Fitzgerald | 2 mg | 332.4 EUR |
Description: Goat anti Mouse IgG+IgA+IgM (H + L) secondary antibody |
|||
Goat anti Monkey IgG + IgA + IgM (H + L) (rhodamine) |
|||
43C-CB1614 | Fitzgerald | 1 mg | 430.8 EUR |
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (Rhodamine) |
|||
Goat anti Human IgG + IgA + IgM (Alk Phos) |
|||
43R-1245 | Fitzgerald | 1 mg | 205.2 EUR |
Description: Goat anti Human IgG + IgA + IgM secondary antibody (Alk Phos) |
|||
Goat anti Human IgG + IgA + IgM (Alk Phos) |
|||
43R-1251 | Fitzgerald | 500 ug | 268.8 EUR |
Description: Goat anti Human IgG + IgA + IgM secondary antibody (Alk Phos) |
|||
Goat anti-Mouse IgG/IgA/IgM Antibody (HRP) |
|||
abx401565-1mg | Abbexa | 1 mg | 594 EUR |