Low Iga And Igm High Igg And Monocolonal

Human IgA, IgG and IgM AssayLite Multiplex Fluorescent Immunoassay Kit

FI700161M3 AssayPro 96 Well Plate 1472.4 EUR

Iga Monoclonal Laboratories manufactures the low iga and igm high igg and monocolonal reagents distributed by Genprice. The Low Iga And Igm High Igg And Monocolonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Low products are available in stock. Specificity: Low Category: Iga Group: And Igm

p5 Ligand for Dnak and and DnaJ

CHI Scientific 4 x 5mg Ask for price

Linsmaier and Skoog, With macro- and micronutrients

GenDepot 10X1L 121.2 EUR

Linsmaier and Skoog, With macro- and micronutrients

GenDepot 50L 151.2 EUR

Murashige and Skoog, With Vitamins and Glycine

GenDepot 10X1L 118.8 EUR

Murashige and Skoog, With Vitamins and Glycine

GenDepot 50L 151.2 EUR

Monoclonal PP2A alpha and beta Antibody

Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

And Igm information

Goat anti Human IgG + IgA + IgM (rhodamine)

43R-1249 Fitzgerald 1 mg 178.8 EUR
Description: Goat anti Human IgG + IgA + IgM secondary antibody  (rhodamine)

Goat anti Human IgG + IgA + IgM (rhodamine)

43R-1255 Fitzgerald 500 ug 223.2 EUR
Description: Goat anti Human IgG + IgA + IgM secondary antibody  (rhodamine)

Goat Anti-Human IgG+IgM+IgA Antibody

20-abx134792 Abbexa
  • 276.00 EUR
  • 343.20 EUR
  • 100 ul
  • 500 ul

Rabbit Anti-Human IgG+IgM+IgA Antibody

20-abx134797 Abbexa
  • 309.60 EUR
  • 410.40 EUR
  • 100 ul
  • 500 ul

Treponema Pallidum IgA, IgG, IgM ELISA Kit

E4675-100 Biovision each 646.8 EUR

Mouse IgA, IgGs (1, 2a, 2b, 3), IgM, and IgE isotype controls (set of 7 IgGs)

20102-SET Alpha Diagnostics 1 Set (100 ugx7) 717.6 EUR

Goat anti Monkey IgG + IgA + IgM (H + L) (HRP)

43C-CB1617 Fitzgerald 1 mg 525.6 EUR
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (HRP)

Goat anti Monkey IgG + IgA + IgM (H + L) (HRP)

43R-IG050hrp Fitzgerald 1 mg 495.6 EUR
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (HRP)

Goat anti Monkey IgG + IgA + IgM (H + L) (FITC)

43C-CB1613 Fitzgerald 1 mg 430.8 EUR
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (FITC)

Goat anti Rat IgG + IgA + IgM (H + L)

41C-CB1257 Fitzgerald 2 mg 342 EUR
Description: Goat anti Rat IgG + IgA + IgM (H + L) secondary antibody

Goat anti Monkey IgG + IgA + IgM (H + L) (biotin)

43C-CB1616 Fitzgerald 1 mg 442.8 EUR
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (biotin)

Goat anti Human IgG + IgA + IgM (H + L)

40C-CB0986 Fitzgerald 2 mg 320.4 EUR
Description: Goat anti Human IgG + IgA + IgM (H + L) secondary antibody

Goat anti Mouse IgG+IgA+IgM (H + L)

41C-CB1599 Fitzgerald 2 mg 332.4 EUR
Description: Goat anti Mouse IgG+IgA+IgM (H + L) secondary antibody

Goat anti Monkey IgG + IgA + IgM (H + L) (rhodamine)

43C-CB1614 Fitzgerald 1 mg 430.8 EUR
Description: Goat anti Monkey IgG + IgA + IgM (H + L) secondary antibody (Rhodamine)

Goat anti Human IgG + IgA + IgM (Alk Phos)

43R-1245 Fitzgerald 1 mg 205.2 EUR
Description: Goat anti Human IgG + IgA + IgM secondary antibody  (Alk Phos)

Goat anti Human IgG + IgA + IgM (Alk Phos)

43R-1251 Fitzgerald 500 ug 268.8 EUR
Description: Goat anti Human IgG + IgA + IgM secondary antibody  (Alk Phos)

Goat anti-Mouse IgG/IgA/IgM Antibody (HRP)

abx401565-1mg Abbexa 1 mg 594 EUR