Iga Nephropathy And Monoclonal Iga
Monoclonal PP2A alpha and beta Antibody |
|||
AMM03147G | Leading Biology | 0.1ml | 580.8 EUR |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Iga Monoclonal Laboratories manufactures the iga nephropathy and monoclonal iga reagents distributed by Genprice. The Iga Nephropathy And Monoclonal Iga reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Nephropathy Group: And Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 471.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 564 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 474 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 495.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 482.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 470.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Mouse Anti Horse Iga Monoclonal Antibody |
|||
DMABT-51963MH | Creative Diagnostics | 2 ml | 889.2 EUR |
Mouse Anti Monkey Iga Monoclonal Antibody |
|||
DMABT-48823MM | Creative Diagnostics | 0.25 mg | 920.4 EUR |
Mouse Anti Bovine Iga Monoclonal Antibody |
|||
DMABT-51899MB | Creative Diagnostics | 0.25 mg | 889.2 EUR |
Rabbit Anti Human JUN Monoclonal Clone IGA-10 |
|||
IRBAHUJUNIGA10C100UL | Innovative research | each | 496 EUR |
Description: Rabbit Anti Human JUN Monoclonal Clone IGA-10 |
|||
Mouse Anti Chicken Iga Monoclonal Antibody |
|||
DMABT-51958MC | Creative Diagnostics | 0.25 mg | 889.2 EUR |
Anti-Mouse IgA, Rabbit Monoclonal Antibody |
|||
A1787-50 | Biovision | each | 444 EUR |
Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/764 |
|||
AMM01638G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC |
|||
Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/515 |
|||
AMM01641G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC |
|||
Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/764 |
|||
AMM01639G | Leading Biology | 0.1mg | 580.8 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC |
|||
Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/515 |
|||
AMM01642G | Leading Biology | 0.1mg | 580.8 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC |
|||
Mouse Anti Human Iga Monoclonal Antibody,FITC |
|||
CABT-48819MH | Creative Diagnostics | 0.1 mg | 889.2 EUR |
Mouse Anti Bovine Iga Monoclonal Antibody,HRP |
|||
DMABT-51898MB | Creative Diagnostics | 0.25 mg | 889.2 EUR |
Mouse Anti Cat Iga Monoclonal Antibody,Biotin |
|||
DMABT-51972MC | Creative Diagnostics | 0.25 mg | 1070.4 EUR |
Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SC05 |
|||
AMM00184G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in WB, IHC and IF, FC, IP, E |
|||
Mouse Anti Bovine/Ovine Iga Monoclonal Antibody |
|||
DMABT-51900MB | Creative Diagnostics | 2 ml | 889.2 EUR |
Mouse Anti Monkey Iga Monoclonal Antibody,Biotin |
|||
DMABT-48822MM | Creative Diagnostics | 0.25 mg | 1070.4 EUR |
Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SPM217 |
|||
AMM00248G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM217. This antibody is applicable in IHC-P, IF, FC |