Iga Nephropathy And Monoclonal Iga

Monoclonal PP2A alpha and beta Antibody

AMM03147G Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Iga Monoclonal Laboratories manufactures the iga nephropathy and monoclonal iga reagents distributed by Genprice. The Iga Nephropathy And Monoclonal Iga reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Nephropathy Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 564 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 474 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 495.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 482.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 470.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

And Monoclonal information

Mouse Anti Horse Iga Monoclonal Antibody

DMABT-51963MH Creative Diagnostics 2 ml 889.2 EUR

Mouse Anti Monkey Iga Monoclonal Antibody

DMABT-48823MM Creative Diagnostics 0.25 mg 920.4 EUR

Mouse Anti Bovine Iga Monoclonal Antibody

DMABT-51899MB Creative Diagnostics 0.25 mg 889.2 EUR

Rabbit Anti Human JUN Monoclonal Clone IGA-10

IRBAHUJUNIGA10C100UL Innovative research each 496 EUR
Description: Rabbit Anti Human JUN Monoclonal Clone IGA-10

Mouse Anti Chicken Iga Monoclonal Antibody

DMABT-51958MC Creative Diagnostics 0.25 mg 889.2 EUR

Anti-Mouse IgA, Rabbit Monoclonal Antibody

A1787-50 Biovision each 444 EUR

Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/764

AMM01638G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/515

AMM01641G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/764

AMM01639G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/515

AMM01642G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC

Mouse Anti Human Iga Monoclonal Antibody,FITC

CABT-48819MH Creative Diagnostics 0.1 mg 889.2 EUR

Mouse Anti Bovine Iga Monoclonal Antibody,HRP

DMABT-51898MB Creative Diagnostics 0.25 mg 889.2 EUR

Mouse Anti Cat Iga Monoclonal Antibody,Biotin

DMABT-51972MC Creative Diagnostics 0.25 mg 1070.4 EUR

Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SC05

AMM00184G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in WB, IHC and IF, FC, IP, E

Mouse Anti Bovine/Ovine Iga Monoclonal Antibody

DMABT-51900MB Creative Diagnostics 2 ml 889.2 EUR

Mouse Anti Monkey Iga Monoclonal Antibody,Biotin

DMABT-48822MM Creative Diagnostics 0.25 mg 1070.4 EUR

Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SPM217

AMM00248G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM217. This antibody is applicable in IHC-P, IF, FC