Iga Nephropathy And Monoclonal Iga

Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SC05

AMM00184G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in WB, IHC and IF, FC, IP, E

Iga Monoclonal Laboratories manufactures the iga nephropathy and monoclonal iga reagents distributed by Genprice. The Iga Nephropathy And Monoclonal Iga reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Nephropathy Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

And Monoclonal information

Cavy Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9905585-INQUIRE MyBiosource INQUIRE Ask for price

Duck Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9905587-INQUIRE MyBiosource INQUIRE Ask for price

Fish Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9905588-INQUIRE MyBiosource INQUIRE Ask for price

Goat Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9905590-INQUIRE MyBiosource INQUIRE Ask for price

Mouse anti IgA Monoclonal Antibody

MBS460226-01mg MyBiosource 0.1mg 285 EUR

Mouse anti IgA Monoclonal Antibody

MBS460226-5x01mg MyBiosource 5x0.1mg 1185 EUR

Human IgA Monoclonal Antibody [15D6]

MBS375476-002mg MyBiosource 0.02mg 335 EUR

Human IgA Monoclonal Antibody [15D6]

MBS375476-005mg MyBiosource 0.05mg 435 EUR

Human IgA Monoclonal Antibody [15D6]

MBS375476-01mg MyBiosource 0.1mg 520 EUR

Human IgA Monoclonal Antibody [15D6]

MBS375476-5x01mg MyBiosource 5x0.1mg 2125 EUR

Mouse anti IgA Monoclonal Antibody

TA354337 Origene Technologies GmbH 100 µg Ask for price

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-01mg MyBiosource 0.1mg 615 EUR

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-5x01mg MyBiosource 5x0.1mg 2720 EUR

Human Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9312782-10x96StripWells MyBiosource 10x96-Strip-Wells 6725 EUR

Human Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9312782-48StripWells MyBiosource 48-Strip-Wells 550 EUR

Human Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9312782-5x96StripWells MyBiosource 5x96-Strip-Wells 3420 EUR

Human Cystinosis, Nephropathic (CTNS) ELISA Kit

MBS9312782-96StripWells MyBiosource 96-Strip-Wells 765 EUR