Iga Nephropathy And Monoclonal Iga
Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SC05 |
|||
AMM00184G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in WB, IHC and IF, FC, IP, E |
Iga Monoclonal Laboratories manufactures the iga nephropathy and monoclonal iga reagents distributed by Genprice. The Iga Nephropathy And Monoclonal Iga reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Nephropathy Group: And Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 471.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Lenti ORF clone of Ctns (mGFP-tagged) - Mouse cystinosis, nephropathic (Ctns) |
|||
MR205647L4 | Origene Technologies GmbH | 10 µg | Ask for price |
HRP*Monoclonal Mouse Anti- Human IgA |
|||
C030249-10ml | Unibiotest | 10ml | 2148 EUR |
HRP*Monoclonal Mouse Anti- Human IgA |
|||
C030249-1ml | Unibiotest | 1ml | 424.8 EUR |
FITC*Monoclonal Mouse Anti- Human IgA |
|||
C030649-10ml | Unibiotest | 10ml | 2148 EUR |
FITC*Monoclonal Mouse Anti- Human IgA |
|||
C030649-1ml | Unibiotest | 1ml | 373.2 EUR |
Lenti ORF clone of Ctns (Myc-DDK-tagged) - Mouse cystinosis, nephropathic (Ctns) |
|||
MR205647L3 | Origene Technologies GmbH | 10 µg | Ask for price |
Mouse Anti Dog Iga Monoclonal Antibody |
|||
DMABT-51916MD | Creative Diagnostics | 2 ml | 889.2 EUR |
Mouse Anti Pig Iga Monoclonal Antibody |
|||
DMABT-51917MP | Creative Diagnostics | 0.25 mg | 920.4 EUR |
Mouse Anti Cat Iga Monoclonal Antibody |
|||
DMABT-51971MC | Creative Diagnostics | 0.25 mg | 920.4 EUR |
Mouse Anti Cat Iga Monoclonal Antibody |
|||
DMABT-51973MC | Creative Diagnostics | 2 ml | 889.2 EUR |
Mouse Anti Pig Iga Monoclonal Antibody |
|||
DMABT-52031MP | Creative Diagnostics | 2 ml | 889.2 EUR |
BIOTIN*Monoclonal Mouse Anti- Human IgA |
|||
C030849-10ml | Unibiotest | 10ml | 2148 EUR |
BIOTIN*Monoclonal Mouse Anti- Human IgA |
|||
C030849-1ml | Unibiotest | 1ml | 424.8 EUR |
Lenti ORF particles, Ctns (GFP-tagged) - Mouse cystinosis, nephropathic (Ctns), 200ul, >10^7 TU/mL |
|||
MR205647L4V | Origene Technologies GmbH | 200 µl | Ask for price |
CTNS (GFP-tagged) - Human cystinosis, nephropathic (CTNS), transcript variant 2 |
|||
RG213151 | Origene Technologies GmbH | 10 µg | Ask for price |
CTNS (GFP-tagged) - Human cystinosis, nephropathic (CTNS), transcript variant 1 |
|||
RG206040 | Origene Technologies GmbH | 10 µg | Ask for price |
CTNS (untagged)-Human cystinosis, nephropathic (CTNS), transcript variant 1 |
|||
SC302528 | Origene Technologies GmbH | 10 µg | Ask for price |