Iga Nephropathy And Monoclonal Iga

Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SC05

AMM00184G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in WB, IHC and IF, FC, IP, E

Iga Monoclonal Laboratories manufactures the iga nephropathy and monoclonal iga reagents distributed by Genprice. The Iga Nephropathy And Monoclonal Iga reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Nephropathy Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

And Monoclonal information

Lenti ORF clone of Ctns (mGFP-tagged) - Mouse cystinosis, nephropathic (Ctns)

MR205647L4 Origene Technologies GmbH 10 µg Ask for price

HRP*Monoclonal Mouse Anti- Human IgA

C030249-10ml Unibiotest 10ml 2148 EUR

HRP*Monoclonal Mouse Anti- Human IgA

C030249-1ml Unibiotest 1ml 424.8 EUR

FITC*Monoclonal Mouse Anti- Human IgA

C030649-10ml Unibiotest 10ml 2148 EUR

FITC*Monoclonal Mouse Anti- Human IgA

C030649-1ml Unibiotest 1ml 373.2 EUR

Lenti ORF clone of Ctns (Myc-DDK-tagged) - Mouse cystinosis, nephropathic (Ctns)

MR205647L3 Origene Technologies GmbH 10 µg Ask for price

Mouse Anti Dog Iga Monoclonal Antibody

DMABT-51916MD Creative Diagnostics 2 ml 889.2 EUR

Mouse Anti Pig Iga Monoclonal Antibody

DMABT-51917MP Creative Diagnostics 0.25 mg 920.4 EUR

Mouse Anti Cat Iga Monoclonal Antibody

DMABT-51971MC Creative Diagnostics 0.25 mg 920.4 EUR

Mouse Anti Cat Iga Monoclonal Antibody

DMABT-51973MC Creative Diagnostics 2 ml 889.2 EUR

Mouse Anti Pig Iga Monoclonal Antibody

DMABT-52031MP Creative Diagnostics 2 ml 889.2 EUR

BIOTIN*Monoclonal Mouse Anti- Human IgA

C030849-10ml Unibiotest 10ml 2148 EUR

BIOTIN*Monoclonal Mouse Anti- Human IgA

C030849-1ml Unibiotest 1ml 424.8 EUR

Lenti ORF particles, Ctns (GFP-tagged) - Mouse cystinosis, nephropathic (Ctns), 200ul, >10^7 TU/mL

MR205647L4V Origene Technologies GmbH 200 µl Ask for price

CTNS (GFP-tagged) - Human cystinosis, nephropathic (CTNS), transcript variant 2

RG213151 Origene Technologies GmbH 10 µg Ask for price

CTNS (GFP-tagged) - Human cystinosis, nephropathic (CTNS), transcript variant 1

RG206040 Origene Technologies GmbH 10 µg Ask for price

CTNS (untagged)-Human cystinosis, nephropathic (CTNS), transcript variant 1

SC302528 Origene Technologies GmbH 10 µg Ask for price