Human Therapeutics And Monoclonal Antibody
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the human therapeutics and monoclonal antibody reagents distributed by Genprice. The Human Therapeutics And Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Therapeutics Group: And Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 564 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 474 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 495.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 482.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 470.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 472.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Anti-SARS-CoV-2, Biosimilar of Therapeutic Antibody |
|||
MBS434345-005mg | MyBiosource | 0.05mg | 305 EUR |
Anti-SARS-CoV-2, Biosimilar of Therapeutic Antibody |
|||
MBS434345-5x005mg | MyBiosource | 5x0.05mg | 1230 EUR |
Therapeutic agent-1 |
|||
HY-153592 | MedChemExpress | 10 mg | 54.11 EUR |
Description: Therapeutic agent-1 is a heteroaryl compound that can be used in Gaucher disease glucocerebrosidase activity enzyme replacement therapy[1]. |
|||
Anti-P.aeruginosa exopolysaccharide Psl Therapeutic Antibody |
|||
TRI-AB-052 | TRI Biotech | 0.1mg | 1620 EUR |
Recombinant Human ACVR2B, Fc-tagged therapeutic protein |
|||
ACVR2B-P014H | Creative BioMart | 100ug | 958.4 EUR |
Recombinant Human ActRIIA therapeutic protein, Fc-tagged |
|||
ACVR2A-P015H | Creative BioMart | 100ug | 958.4 EUR |
CeraVe Therapeutic Hand Cream , 3 Oz |
|||
LC3035-001 | GenDepot | Ea | 84 EUR |
Recombinant Hu-rhEGF-rP64k/Mont Therapeutic Vaccine |
|||
THP-0327 | Creative BioMart | 1 vial | 2398.4 EUR |
Description: Protein |
|||
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
E10-20129 | EnoGene | 100ul | 225 EUR |
Description: Available in various conjugation types. |
|||
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
E10-20130 | EnoGene | 100ul | 225 EUR |
Description: Available in various conjugation types. |
|||
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
MBS8527480-01mL | MyBiosource | 0.1mL | 305 EUR |
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
MBS8527480-01mLAF405L | MyBiosource | 0.1mL(AF405L) | 565 EUR |
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
MBS8527480-01mLAF405S | MyBiosource | 0.1mL(AF405S) | 565 EUR |
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
MBS8527480-01mLAF610 | MyBiosource | 0.1mL(AF610) | 565 EUR |
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
MBS8527480-01mLAF635 | MyBiosource | 0.1mL(AF635) | 565 EUR |
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
MBS8527481-01mL | MyBiosource | 0.1mL | 305 EUR |
Mouse Monoclonal Antibody to P16 (Mouse and Human) |
|||
MBS8527481-01mLAF405L | MyBiosource | 0.1mL(AF405L) | 565 EUR |