Human Therapeutics And Monoclonal Antibody

Lab Reagents

Human Antibody Laboratories manufactures the human therapeutics and monoclonal antibody reagents distributed by Genprice. The Human Therapeutics And Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Therapeutics Group: And Monoclonal

And Monoclonal information

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-HRP 0.1mg
EUR 387
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-P594 0.1mg
EUR 406
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-PCP 0.1mg
EUR 398
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE 0.1mg
EUR 396
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR 0.1mg
EUR 397
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S 0.012mg
EUR 65
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human)

4-MAB555Hu22
  • EUR 221.00
  • EUR 2114.00
  • EUR 535.00
  • EUR 274.00
  • EUR 203.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17)

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), APC

4-MAB555Hu22-APC
  • EUR 307.00
  • EUR 2735.00
  • EUR 777.00
  • EUR 386.00
  • EUR 203.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with APC.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), Biotinylated

4-MAB555Hu22-Biotin
  • EUR 283.00
  • EUR 2064.00
  • EUR 628.00
  • EUR 341.00
  • EUR 207.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with Biotin.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), Cy3

4-MAB555Hu22-Cy3
  • EUR 368.00
  • EUR 3605.00
  • EUR 995.00
  • EUR 473.00
  • EUR 229.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with Cy3.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), FITC

4-MAB555Hu22-FITC
  • EUR 266.00
  • EUR 2208.00
  • EUR 642.00
  • EUR 328.00
  • EUR 182.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with FITC.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), HRP

4-MAB555Hu22-HRP
  • EUR 283.00
  • EUR 2387.00
  • EUR 690.00
  • EUR 351.00
  • EUR 192.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with HRP.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), PE

4-MAB555Hu22-PE
  • EUR 266.00
  • EUR 2208.00
  • EUR 642.00
  • EUR 328.00
  • EUR 182.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with PE.

Mouse Anti Human Macrophage (Tissue And Proliferative Disorders) Monoclonal Antibody

DMABT-52185MH 0.5 ml
EUR 1022

Carica papaya Papain ELISA kit (for measuring papain residue/contaminant in therapeutics), 96 tests

800-160-CPP 1 Kit
EUR 773

Anti-S100B (Astrocyte and Melanoma Marker) Monoclonal Antibody

M00979 100ug/vial
EUR 397
Description: Mouse Monoclonal S100B (Astrocyte and Melanoma Marker) Antibody. Validated in IHC and tested in Bovine, Human, Rabbit, Rat.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), APC-Cy7

4-MAB555Hu22-APC-Cy7
  • EUR 495.00
  • EUR 5350.00
  • EUR 1435.00
  • EUR 652.00
  • EUR 286.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with APC-Cy7.