Human Therapeutics And Monoclonal Antibody

Monoclonal PP2A alpha and beta Antibody

AMM03147G Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Antibody Laboratories manufactures the human therapeutics and monoclonal antibody reagents distributed by Genprice. The Human Therapeutics And Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Therapeutics Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 564 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 474 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 495.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 482.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 470.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

And Monoclonal information

Recombinant Human CSF3 therapeutic protein

CSF3-P054H Creative BioMart 20ug 158.4 EUR
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Recombinant Human IDUA therapeutic protein

IDUA-P025H Creative BioMart 5ug 238.4 EUR
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Anti-P.aeruginosa exopolysaccharide Psl Therapeutic Antibody

TRI-AB-052 TRI Biotech 0.1mg 1620 EUR

Therapeutic agent-1

HY-153592 MedChemExpress 10 mg 54.11 EUR
Description: Therapeutic agent-1 is a heteroaryl compound that can be used in Gaucher disease glucocerebrosidase activity enzyme replacement therapy[1].

Recombinant Human ACVR2B, Fc-tagged therapeutic protein

ACVR2B-P014H Creative BioMart 100ug 958.4 EUR

Recombinant Human ActRIIA therapeutic protein, Fc-tagged

ACVR2A-P015H Creative BioMart 100ug 958.4 EUR

CeraVe Therapeutic Hand Cream , 3 Oz

LC3035-001 GenDepot Ea 84 EUR

Recombinant Hu-rhEGF-rP64k/Mont Therapeutic Vaccine

THP-0327 Creative BioMart 1 vial 2398.4 EUR
Description: Protein

Mouse Monoclonal Antibody to P16 (Mouse and Human)

E10-20129 EnoGene 100ul 225 EUR
Description: Available in various conjugation types.

Mouse Monoclonal Antibody to P16 (Mouse and Human)

E10-20130 EnoGene 100ul 225 EUR
Description: Available in various conjugation types.

Mouse Monoclonal Antibody to P16 (Mouse and Human)

sAP-0102 Angio Proteomie 50ug 270 EUR

Mouse Monoclonal Antibody to P16 (Mouse and Human)

sAP-0103 Angio Proteomie 50ug 270 EUR

Mouse Monoclonal Antibody to P16 (Mouse and Human)

MBS8527480-01mL MyBiosource 0.1mL 305 EUR

Mouse Monoclonal Antibody to P16 (Mouse and Human)

MBS8527480-01mLAF405L MyBiosource 0.1mL(AF405L) 565 EUR

Mouse Monoclonal Antibody to P16 (Mouse and Human)

MBS8527480-01mLAF405S MyBiosource 0.1mL(AF405S) 565 EUR

Mouse Monoclonal Antibody to P16 (Mouse and Human)

MBS8527480-01mLAF610 MyBiosource 0.1mL(AF610) 565 EUR

Mouse Monoclonal Antibody to P16 (Mouse and Human)

MBS8527480-01mLAF635 MyBiosource 0.1mL(AF635) 565 EUR