Human Therapeutics And Monoclonal Antibody

Lab Reagents

Human Antibody Laboratories manufactures the human therapeutics and monoclonal antibody reagents distributed by Genprice. The Human Therapeutics And Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Therapeutics Group: And Monoclonal

And Monoclonal information

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-PCP Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE Stressmarq 0.1mg 475.2 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR Stressmarq 0.1mg 476.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S Stressmarq 0.012mg 78 EUR
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal P16 (Mouse and Human) Antibody, Clone: 1E12E10

AMM02637G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human P16 (Mouse and Human). The antibodies are raised in Mouse and are from clone 1E12E10. This antibody is applicable in WB and IHC, E

Rat Anti Human Macrophages And Neutrophils Monoclonal Antibody

DMABT-49599RH Creative Diagnostics 200 TEST 920.4 EUR

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human)

4-MAB555Hu22 Cloud-Clone
  • 265.20 EUR
  • 2536.80 EUR
  • 642.00 EUR
  • 328.80 EUR
  • 243.60 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17)

Mouse Anti Human Macrophage (Tissue And Proliferative Disorders) Monoclonal Antibody

DMABT-52185MH Creative Diagnostics 0.5 ml 1226.4 EUR

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), APC

4-MAB555Hu22-APC Cloud-Clone
  • 368.40 EUR
  • 3282.00 EUR
  • 932.40 EUR
  • 463.20 EUR
  • 243.60 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with APC.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), Biotinylated

4-MAB555Hu22-Biotin Cloud-Clone
  • 339.60 EUR
  • 2476.80 EUR
  • 753.60 EUR
  • 409.20 EUR
  • 248.40 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with Biotin.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), Cy3

4-MAB555Hu22-Cy3 Cloud-Clone
  • 441.60 EUR
  • 4326.00 EUR
  • 1194.00 EUR
  • 567.60 EUR
  • 274.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with Cy3.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), FITC

4-MAB555Hu22-FITC Cloud-Clone
  • 319.20 EUR
  • 2649.60 EUR
  • 770.40 EUR
  • 393.60 EUR
  • 218.40 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with FITC.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), HRP

4-MAB555Hu22-HRP Cloud-Clone
  • 339.60 EUR
  • 2864.40 EUR
  • 828.00 EUR
  • 421.20 EUR
  • 230.40 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with HRP.

A Disintegrin And Metalloprotease 17 (ADAM17) Monoclonal Antibody (Human), PE

4-MAB555Hu22-PE Cloud-Clone
  • 319.20 EUR
  • 2649.60 EUR
  • 770.40 EUR
  • 393.60 EUR
  • 218.40 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloprotease 17 (ADAM17). This antibody is labeled with PE.

Carica papaya Papain ELISA kit (for measuring papain residue/contaminant in therapeutics), 96 tests

800-160-CPP Alpha Diagnostics 1 Kit 927.6 EUR

Anti-S100B (Astrocyte and Melanoma Marker) Monoclonal Antibody

M00979 BosterBio 100ug/vial 476.4 EUR
Description: Mouse Monoclonal S100B (Astrocyte and Melanoma Marker) Antibody. Validated in IHC and tested in Bovine, Human, Rabbit, Rat.

A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4) Monoclonal Antibody (Human)

4-MAK204Hu21 Cloud-Clone
  • 306.00 EUR
  • 3170.40 EUR
  • 786.00 EUR
  • 386.40 EUR
  • 260.40 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)