Flu Shots And Monoclonal Antibodies
Anti-Myc and Anti-DDK monoclonal antibodies |
|||
TA150014 | Origene Technologies GmbH | 2 tubes @ 50 ul each | Ask for price |
Human IgG antibody Laboratories manufactures the flu shots and monoclonal antibodies reagents distributed by Genprice. The Flu Shots And Monoclonal Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact influenza Antibody. Other Flu products are available in stock. Specificity: Flu Category: Shots Group: And Monoclonal
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
BlueGene | 192 tests | 1524 EUR |
Description: A competitive ELISA for quantitative measurement of Human Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
||
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
BlueGene | 1 plate of 48 wells | 624 EUR |
Description: A competitive ELISA for quantitative measurement of Human Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
||
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
BlueGene | 1 plate of 96 wells | 822 EUR |
Description: A competitive ELISA for quantitative measurement of Human Anti centriole and centrosome antibody IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
||
Human Anti centriole and centrosome antibody IgG ELISA kit |
||
BlueGene | 96T | 700 EUR |
Description: ELISA |
||
Monoclonal PP2A alpha and beta Antibody |
||
Leading Biology | 0.1ml | 580.8 EUR |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 480 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCA1520-250 | Biotium | 250uL | 459.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCR1520-250 | Biotium | 250uL | 459.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCH1520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCH1520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCP1520-250 | Biotium | 250uL | 459.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),PerCP conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCB1520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCB1520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-100 | Biotium | 100uL | 250.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-500 | Biotium | 500uL | 549.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUM1520-50 | Biotium | 50uL | 474 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC471520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC471520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC611520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC611520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC431520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF543 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC431520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF543 conjugate, Concentration: 0.1mg/mL |