Flu Shots And Monoclonal Antibodies
Human Cardiolipin Antibodies, IgA, IgG and IgM AssayLite Multiplex Fluorescent Immunoassay Kit |
|||
FAA3CARL | AssayPro | 96 Well Plate | 1472.4 EUR |
Human IgG antibody Laboratories manufactures the flu shots and monoclonal antibodies reagents distributed by Genprice. The Flu Shots And Monoclonal Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact influenza Antibody. Other Flu products are available in stock. Specificity: Flu Category: Shots Group: And Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 471.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 564 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 474 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 495.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC941520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF594 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC941520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF594 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCA1520-250 | Biotium | 250uL | 459.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-100 | Biotium | 100uL | 250.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-500 | Biotium | 500uL | 549.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC041520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC041520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC881520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC881520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC701520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF770 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC701520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF770 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC681520-100 | Biotium | 100uL | 238.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC681520-500 | Biotium | 500uL | 652.8 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL |
|||
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCR1520-250 | Biotium | 250uL | 459.6 EUR |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL |
|||
Monoclonal Serum amyloid Antibodies P-Component (N-term), Clone: EP1018Y |
|||
APR13293G | Leading Biology | 0.1ml | 633.6 EUR |
Description: A Monoclonal antibody against Human Serum amyloid Antibodies P-Component (N-term). The antibodies are raised in Rabbit and are from clone EP1018Y. This antibody is applicable in WB and IHC |