Elisa Monoclonal And Polyclonal Testing
Monoclonal PP2A alpha and beta Antibody |
|||
AMM03147G | Leading Biology | 0.1ml | 580.8 EUR |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human IgG antibody Laboratories manufactures the elisa monoclonal and polyclonal testing reagents distributed by Genprice. The Elisa Monoclonal And Polyclonal Testing reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact monoclonal elisa. Other Elisa products are available in stock. Specificity: Elisa Category: Monoclonal Group: And Polyclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 471.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 564 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 474 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 495.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 482.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 470.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
M720 720L Materials Testing Oven |
|||
INC1068 | Scientific Laboratory Supplies | EACH | 15962.27 EUR |
M240 240L Materials Testing Oven |
|||
INC1070 | Scientific Laboratory Supplies | EACH | 11303.88 EUR |
M400 400L Materials Testing Oven |
|||
INC1072 | Scientific Laboratory Supplies | EACH | 13757.11 EUR |
Materials Testing Oven M115 115L |
|||
INC1146 | Scientific Laboratory Supplies | EACH | 9644.47 EUR |
FP240 240L Materials Testing Oven |
|||
INC1062 | Scientific Laboratory Supplies | EACH | 5994.01 EUR |
FP400 400L Materials Testing Oven |
|||
INC1064 | Scientific Laboratory Supplies | EACH | 7735.68 EUR |
FP720 720L Materials Testing Oven |
|||
INC1066 | Scientific Laboratory Supplies | EACH | 9711.05 EUR |
Materials Testing Oven FP115 115L |
|||
INC1144 | Scientific Laboratory Supplies | EACH | 4339.81 EUR |
Custom Testing of Samples for Basiliximab (Simulect) by ELISA |
|||
210-320-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of Samples for Lucentis/Ranibizumab by ELISA |
|||
200-880-CUX | Alpha Diagnostics | Custom | Ask for price |
Reducing Agent (for Silica Testing) |
|||
RAST01 | Scientific Laboratory Supplies | 100ML | 127.95 EUR |
Custom Testing of Samples for Herceptin/Trastuzumab by ELISA |
|||
200-510-CUX | Alpha Diagnostics | Custom | Ask for price |
Methyl Red 0.1% 250ml Dairy Testing |
|||
DAI1124 | Scientific Laboratory Supplies | EACH | 271.2 EUR |
Cryoscope Bath Liquid Dairy Testing |
|||
CRYBL | Scientific Laboratory Supplies | 500ML | 31.2 EUR |
Phenolphthalein 1% 2.5L Dairy Testing |
|||
DAI1126 | Scientific Laboratory Supplies | EACH | 255.6 EUR |
Phenolphthalein 0.5% 1L Dairy Testing |
|||
DAI1130 | Scientific Laboratory Supplies | EACH | 84.86 EUR |
Phenolphthalein 1% 1L Dairy Testing |
|||
IPT10F | Scientific Laboratory Supplies | 1L | 104.4 EUR |