Elisa Monoclonal And Polyclonal Testing

Monoclonal PP2A alpha and beta Antibody

AMM03147G Leading Biology 0.1ml 580.8 EUR
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human IgG antibody Laboratories manufactures the elisa monoclonal and polyclonal testing reagents distributed by Genprice. The Elisa Monoclonal And Polyclonal Testing reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact monoclonal elisa. Other Elisa products are available in stock. Specificity: Elisa Category: Monoclonal Group: And Polyclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 564 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 474 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 495.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 482.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 470.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

And Polyclonal information

M720 720L Materials Testing Oven

INC1068 Scientific Laboratory Supplies EACH 15962.27 EUR

M240 240L Materials Testing Oven

INC1070 Scientific Laboratory Supplies EACH 11303.88 EUR

M400 400L Materials Testing Oven

INC1072 Scientific Laboratory Supplies EACH 13757.11 EUR

Materials Testing Oven M115 115L

INC1146 Scientific Laboratory Supplies EACH 9644.47 EUR

FP240 240L Materials Testing Oven

INC1062 Scientific Laboratory Supplies EACH 5994.01 EUR

FP400 400L Materials Testing Oven

INC1064 Scientific Laboratory Supplies EACH 7735.68 EUR

FP720 720L Materials Testing Oven

INC1066 Scientific Laboratory Supplies EACH 9711.05 EUR

Materials Testing Oven FP115 115L

INC1144 Scientific Laboratory Supplies EACH 4339.81 EUR

Custom Testing of Samples for Basiliximab (Simulect) by ELISA

210-320-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Lucentis/Ranibizumab by ELISA

200-880-CUX Alpha Diagnostics Custom Ask for price

Reducing Agent (for Silica Testing)

RAST01 Scientific Laboratory Supplies 100ML 127.95 EUR

Custom Testing of Samples for Herceptin/Trastuzumab by ELISA

200-510-CUX Alpha Diagnostics Custom Ask for price

Methyl Red 0.1% 250ml Dairy Testing

DAI1124 Scientific Laboratory Supplies EACH 271.2 EUR

Cryoscope Bath Liquid Dairy Testing

CRYBL Scientific Laboratory Supplies 500ML 31.2 EUR

Phenolphthalein 1% 2.5L Dairy Testing

DAI1126 Scientific Laboratory Supplies EACH 255.6 EUR

Phenolphthalein 0.5% 1L Dairy Testing

DAI1130 Scientific Laboratory Supplies EACH 84.86 EUR

Phenolphthalein 1% 1L Dairy Testing

IPT10F Scientific Laboratory Supplies 1L 104.4 EUR