Elevated Iga And Monoclonal Protein Present
BBP11-VP peel and present accessory - EACH |
|||
| LAB6014 | Scientific Laboratory Supplies | EACH | 51.44 EUR |
Iga Monoclonal Laboratories manufactures the elevated iga and monoclonal protein present reagents distributed by Genprice. The Elevated Iga And Monoclonal Protein Present reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Elevated products are available in stock. Specificity: Elevated Category: Iga Group: And Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 480 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 478.8 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 478.8 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 478.8 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 478.8 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 478.8 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | 478.8 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
||
Rat Lactation elevated protein 1, LACE1 ELISA Kit |
|||
| MBS9341131-96StripWells | MyBiosource | 96-Strip-Wells | 765 EUR |
Lactation Elevated Protein 1 (LACE1) Antibody (Biotin) |
|||
| abx308836-100g | Abbexa | 100 µg | 362.5 EUR |
Lactation Elevated Protein 1 (LACE1) Antibody (Biotin) |
|||
| 20-abx308836 | Abbexa |
|
|
Lactation Elevated Protein 1 (LACE1) Antibody (Biotin) |
|||
| abx308836-20g | Abbexa | 20 µg | 162.5 EUR |
Lactation Elevated Protein 1 (LACE1) Antibody (Biotin) |
|||
| abx308836-50g | Abbexa | 50 µg | 250 EUR |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|||
| MBS1306217-002mgBaculovirus | MyBiosource | 0.02mg(Baculovirus) | 1345 EUR |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|||
| MBS1306217-002mgEColi | MyBiosource | 0.02mg(E-Coli) | 1045 EUR |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|||
| MBS1306217-002mgYeast | MyBiosource | 0.02mg(Yeast) | 1140 EUR |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|||
| MBS1306217-01mgEColi | MyBiosource | 0.1mg(E-Coli) | 1220 EUR |
Recombinant Rat Lactation elevated protein 1 (Lace1) |
|||
| MBS1306217-01mgYeast | MyBiosource | 0.1mg(Yeast) | 1300 EUR |
Human Lactation Elevated Protein 1 (AFG1L) ELISA Kit |
|||
| abx385075-96tests | Abbexa | 96 tests | 687.5 EUR |
Mouse Lactation elevated protein 2 (LACE1) ELISA Kit |
|||
| abx389701-1096tests | Abbexa | 10 × 96 tests | Ask for price |
Mouse Lactation elevated protein 2 (LACE1) ELISA Kit |
|||
| abx389701-596tests | Abbexa | 5 × 96 tests | Ask for price |
Mouse Lactation elevated protein 2 (LACE1) ELISA Kit |
|||
| abx389701-96tests | Abbexa | 96 tests | 687.5 EUR |
Mouse Lactation elevated protein 1, Lace1 ELISA KIT |
|||
| ELI-28039m | Lifescience Market | 96 Tests | 1038 EUR |
Human Lactation elevated protein 1, LACE1 ELISA KIT |
|||
| ELI-42677h | Lifescience Market | 96 Tests | 988.8 EUR |
Mouse Lactation elevated protein 1, LACE1 ELISA Kit |
|||
| MBS9331943-10x96StripWells | MyBiosource | 10x96-Strip-Wells | 6725 EUR |
