Elevated Iga And Monoclonal Protein Present

BBP11-VP peel and present accessory - EACH
LAB6014 Scientific Laboratory Supplies EACH 51.44 EUR

Iga Monoclonal Laboratories manufactures the elevated iga and monoclonal protein present reagents distributed by Genprice. The Elevated Iga And Monoclonal Protein Present reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Elevated products are available in stock. Specificity: Elevated Category: Iga Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 480 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

And Monoclonal information

Rat Lactation elevated protein 1, LACE1 ELISA Kit
MBS9341131-96StripWells MyBiosource 96-Strip-Wells 765 EUR

Lactation Elevated Protein 1 (LACE1) Antibody (Biotin)
abx308836-100g Abbexa 100 µg 362.5 EUR

Lactation Elevated Protein 1 (LACE1) Antibody (Biotin)
20-abx308836 Abbexa
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20 ug
  • 50 ug
  • 100 ug
  • 200 ug
  • 1 mg

Lactation Elevated Protein 1 (LACE1) Antibody (Biotin)
abx308836-20g Abbexa 20 µg 162.5 EUR

Lactation Elevated Protein 1 (LACE1) Antibody (Biotin)
abx308836-50g Abbexa 50 µg 250 EUR

Recombinant Rat Lactation elevated protein 1 (Lace1)
MBS1306217-002mgBaculovirus MyBiosource 0.02mg(Baculovirus) 1345 EUR

Recombinant Rat Lactation elevated protein 1 (Lace1)
MBS1306217-002mgEColi MyBiosource 0.02mg(E-Coli) 1045 EUR

Recombinant Rat Lactation elevated protein 1 (Lace1)
MBS1306217-002mgYeast MyBiosource 0.02mg(Yeast) 1140 EUR

Recombinant Rat Lactation elevated protein 1 (Lace1)
MBS1306217-01mgEColi MyBiosource 0.1mg(E-Coli) 1220 EUR

Recombinant Rat Lactation elevated protein 1 (Lace1)
MBS1306217-01mgYeast MyBiosource 0.1mg(Yeast) 1300 EUR

Mouse Lactation elevated protein 2 (LACE1) ELISA Kit
abx389701-1096tests Abbexa 10 × 96 tests Ask for price

Mouse Lactation elevated protein 2 (LACE1) ELISA Kit
abx389701-596tests Abbexa 5 × 96 tests Ask for price

Mouse Lactation elevated protein 2 (LACE1) ELISA Kit
abx389701-96tests Abbexa 96 tests 687.5 EUR

Human Lactation Elevated Protein 1 (AFG1L) ELISA Kit
abx385075-96tests Abbexa 96 tests 687.5 EUR

Human Lactation elevated protein 1, LACE1 ELISA KIT
ELI-42677h Lifescience Market 96 Tests 988.8 EUR

Mouse Lactation elevated protein 1, Lace1 ELISA KIT
ELI-28039m Lifescience Market 96 Tests 1038 EUR

Human Lactation elevated protein 1, LACE1 ELISA Kit
MBS9323506-10x96StripWells MyBiosource 10x96-Strip-Wells 6725 EUR