Elevated Iga And Monoclonal Protein Present
BBP11-VP peel and present accessory |
|||
LAB6014 | Scientific Laboratory Supplies | EACH | 45.72 EUR |
Iga Monoclonal Laboratories manufactures the elevated iga and monoclonal protein present reagents distributed by Genprice. The Elevated Iga And Monoclonal Protein Present reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Elevated products are available in stock. Specificity: Elevated Category: Iga Group: And Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 478.8 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 471.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 477.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 564 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 474 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 495.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | 482.4 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal Presenilin-2 Antibody, Clone: EP1515Y |
|||
AMR09511G | Leading Biology | 0.1ml | 633.6 EUR |
Description: A Monoclonal antibody against Human Presenilin-2. The antibodies are raised in Rabbit and are from clone EP1515Y. This antibody is applicable in WB and IHC |
|||
Monoclonal Presenilin-1 Antibody, Clone: EP2000Y |
|||
APR07164G | Leading Biology | 0.1ml | 633.6 EUR |
Description: A Monoclonal antibody against Human Presenilin-1. The antibodies are raised in Rabbit and are from clone EP2000Y. This antibody is applicable in WB and IHC |
|||
Rat Monoclonal Anti-Human Presenilin 1 (PS-1) ascites #2 |
|||
PS12-M | Alpha Diagnostics | 100 ul | 578.4 EUR |
Monoclonal Presenilin-2 Antibody Phospho (pS330), Clone: EP2614 |
|||
AMR09513G | Leading Biology | 0.1ml | 633.6 EUR |
Description: A Monoclonal antibody against Human Presenilin-2 Phospho (pS330). The antibodies are raised in Rabbit and are from clone EP2614. This antibody is applicable in WB |
|||
Monoclonal Presenilin-1 Antibody Phospho (pS310), Clone: EP2001Y |
|||
AMR09510G | Leading Biology | 0.1ml | 633.6 EUR |
Description: A Monoclonal antibody against Human Presenilin-1 Phospho (pS310). The antibodies are raised in Rabbit and are from clone EP2001Y. This antibody is applicable in WB |
|||
Monoclonal Presenilin-2 Antibody Phospho (pS327), Clone: EP2613Y |
|||
AMR09512G | Leading Biology | 0.1ml | 633.6 EUR |
Description: A Monoclonal antibody against Human Presenilin-2 Phospho (pS327). The antibodies are raised in Rabbit and are from clone EP2613Y. This antibody is applicable in WB |
|||
Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/764 |
|||
AMM01638G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC |
|||
Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/515 |
|||
AMM01641G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC |
|||
Monoclonal Mouse Anti-Human IgA |
|||
C010208-10mg | Unibiotest | 10mg | 1336.8 EUR |
Monoclonal Mouse Anti-Human IgA |
|||
C010208-1mg | Unibiotest | 1mg | 322.8 EUR |
Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/764 |
|||
AMM01639G | Leading Biology | 0.1mg | 580.8 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC |
|||
Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/515 |
|||
AMM01642G | Leading Biology | 0.1mg | 580.8 EUR |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC |
|||
HRP*Monoclonal Mouse Anti- Human IgA |
|||
C030249-10ml | Unibiotest | 10ml | 2148 EUR |
HRP*Monoclonal Mouse Anti- Human IgA |
|||
C030249-1ml | Unibiotest | 1ml | 424.8 EUR |
FITC*Monoclonal Mouse Anti- Human IgA |
|||
C030649-10ml | Unibiotest | 10ml | 2148 EUR |
FITC*Monoclonal Mouse Anti- Human IgA |
|||
C030649-1ml | Unibiotest | 1ml | 373.2 EUR |
Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SC05 |
|||
AMM00184G | Leading Biology | 0.05mg | 475.2 EUR |
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in WB, IHC and IF, FC, IP, E |