Elevated Iga And Monoclonal Protein Present

BBP11-VP peel and present accessory - EACH

LAB6014 Scientific Laboratory Supplies EACH 51.44 EUR

Iga Monoclonal Laboratories manufactures the elevated iga and monoclonal protein present reagents distributed by Genprice. The Elevated Iga And Monoclonal Protein Present reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Elevated products are available in stock. Specificity: Elevated Category: Iga Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

And Monoclonal information

Lactation Elevated Protein 1 (LACE1) Antibody (Biotin)

abx308836-50g Abbexa 50 µg 250 EUR

Human Lactation elevated protein 1, LACE1 ELISA KIT

ELI-42677h Lifescience Market 96 Tests 988.8 EUR

Mouse Lactation elevated protein 1, Lace1 ELISA KIT

ELI-28039m Lifescience Market 96 Tests 1038 EUR

Human Lactation Elevated Protein 1 (AFG1L) ELISA Kit

abx385075-96tests Abbexa 96 tests 1093.2 EUR

Mouse Lactation elevated protein 2 (LACE1) ELISA Kit

abx389701-96tests Abbexa 96 tests 1093.2 EUR

Mouse Lactation elevated protein 2 (LACE1) ELISA Kit

abx389701-1096tests Abbexa 10 × 96 tests Ask for price

Mouse Lactation elevated protein 2 (LACE1) ELISA Kit

abx389701-596tests Abbexa 5 × 96 tests Ask for price

Lace1 ELISA Kit| Rat Lactation elevated protein 1 ELISA Kit

EF018892 Lifescience Market 96 Tests 826.8 EUR

Lace1 ELISA Kit| Mouse Lactation elevated protein 1 ELISA Kit

EF015336 Lifescience Market 96 Tests 826.8 EUR

Human Serum Albumin (PSA Elevated)

90-CS1084 Fitzgerald 1 ml 95 EUR
Description: Human Serum Albumin (PSA Elevated)

Axygen 96 well PCR plate clear with no skirt and elevated wells 200ul - PK10

AXY2128 Scientific Laboratory Supplies PK10 68.85 EUR

LACE1 (untagged)-Human lactation elevated 1 (LACE1)

SC123228 Origene Technologies GmbH 10 µg Ask for price

Axygen 96 well PCR plate clear with elevated skirt and single notch corner 200ul - PK10

AXY2096 Scientific Laboratory Supplies PK10 82.35 EUR

Axygen 96 well PCR plate clear with elevated skirt and single notch corner 200ul - PK50

AXY2126 Scientific Laboratory Supplies PK50 391.5 EUR

LACE1 (GFP-tagged) - Human lactation elevated 1 (LACE1)

RG202313 Origene Technologies GmbH 10 µg Ask for price

Freezing Griddle/Elevated Freezing Block Set, per set

IW-P119 IHC World - 385 EUR

Lace1 (untagged) - Mouse lactation elevated 1 (Lace1), (10ug)

MC216712 Origene Technologies GmbH 10 µg Ask for price