Elevated Iga And Monoclonal Protein Present

BBP11-VP peel and present accessory

LAB6014 Scientific Laboratory Supplies EACH 45.72 EUR

Iga Monoclonal Laboratories manufactures the elevated iga and monoclonal protein present reagents distributed by Genprice. The Elevated Iga And Monoclonal Protein Present reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Elevated products are available in stock. Specificity: Elevated Category: Iga Group: And Monoclonal

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 471.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 477.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 564 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 474 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 495.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

Stressmarq 0.1mg 482.4 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

And Monoclonal information

Monoclonal Presenilin-2 Antibody, Clone: EP1515Y

AMR09511G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human Presenilin-2. The antibodies are raised in Rabbit and are from clone EP1515Y. This antibody is applicable in WB and IHC

Monoclonal Presenilin-1 Antibody, Clone: EP2000Y

APR07164G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human Presenilin-1. The antibodies are raised in Rabbit and are from clone EP2000Y. This antibody is applicable in WB and IHC

Rat Monoclonal Anti-Human Presenilin 1 (PS-1) ascites #2

PS12-M Alpha Diagnostics 100 ul 578.4 EUR

Monoclonal Presenilin-2 Antibody Phospho (pS330), Clone: EP2614

AMR09513G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human Presenilin-2 Phospho (pS330). The antibodies are raised in Rabbit and are from clone EP2614. This antibody is applicable in WB

Monoclonal Presenilin-1 Antibody Phospho (pS310), Clone: EP2001Y

AMR09510G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human Presenilin-1 Phospho (pS310). The antibodies are raised in Rabbit and are from clone EP2001Y. This antibody is applicable in WB

Monoclonal Presenilin-2 Antibody Phospho (pS327), Clone: EP2613Y

AMR09512G Leading Biology 0.1ml 633.6 EUR
Description: A Monoclonal antibody against Human Presenilin-2 Phospho (pS327). The antibodies are raised in Rabbit and are from clone EP2613Y. This antibody is applicable in WB

Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/764

AMM01638G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody - With BSA and Azide, Clone: IGA/515

AMM01641G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC

Monoclonal Mouse Anti-Human IgA

C010208-10mg Unibiotest 10mg 1336.8 EUR

Monoclonal Mouse Anti-Human IgA

C010208-1mg Unibiotest 1mg 322.8 EUR

Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/764

AMM01639G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody - Without BSA and Azide, Clone: IGA/515

AMM01642G Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC

HRP*Monoclonal Mouse Anti- Human IgA

C030249-10ml Unibiotest 10ml 2148 EUR

HRP*Monoclonal Mouse Anti- Human IgA

C030249-1ml Unibiotest 1ml 424.8 EUR

FITC*Monoclonal Mouse Anti- Human IgA

C030649-10ml Unibiotest 10ml 2148 EUR

FITC*Monoclonal Mouse Anti- Human IgA

C030649-1ml Unibiotest 1ml 373.2 EUR

Monoclonal IgA Secretory Component / ECM1 Antibody - With BSA and Azide, Clone: SC05

AMM00184G Leading Biology 0.05mg 475.2 EUR
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1 - With BSA and Azide. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in WB, IHC and IF, FC, IP, E