Anti Ige And Receptor Antibodies For Chronic Urticaria

Anti-Myc and Anti-DDK monoclonal antibodies
TA150014 Origene Technologies GmbH 2 tubes @ 50 ul each Ask for price

Ige Antibody Laboratories manufactures the anti ige and receptor antibodies for chronic urticaria reagents distributed by Genprice. The Anti Ige And Receptor Antibodies For Chronic Urticaria reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige antibody. Other Anti products are available in stock. Specificity: Anti Category: Ige Group: And Receptor

Monoclonal ZAP70 (Chronic Lymphocytic Leukemia Marker) Antibody - Without BSA and Azide, Clone: SPM362
Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human ZAP70 (Chronic Lymphocytic Leukemia Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM362. This antibody is applicable in IHC, IF, FC

Monoclonal ZAP70 (Chronic Lymphocytic Leukemia Marker) Antibody - Without BSA and Azide, Clone: 2F3.2
Leading Biology 0.1mg 580.8 EUR
Description: A Monoclonal antibody against Human ZAP70 (Chronic Lymphocytic Leukemia Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone 2F3.2. This antibody is applicable in IHC, IF, FC

Custom ELISA testing for anthrax antibodies in animal and human samples (vaccinated or normal)
Alpha Diagnostics Custom Ask for price

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 480 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq 0.1mg 478.8 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

And Receptor information

Human Anti M2 cholinergic receptor antibodies ELISA kit
E01A0355 BlueGene 96T 700 EUR
Description: ELISA

Sheep Anti M2 cholinergic receptor antibodies ELISA kit
E01A96332 BlueGene 96T 700 EUR
Description: ELISA

Monkey Anti M2 cholinergic receptor antibodies ELISA kit
E09A0812-192T BlueGene 192 tests 1524 EUR
Description: A competitive ELISA for quantitative measurement of Monkey Anti M2 cholinergic receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Anti M2 cholinergic receptor antibodies ELISA kit
E09A0812-48 BlueGene 1 plate of 48 wells 624 EUR
Description: A competitive ELISA for quantitative measurement of Monkey Anti M2 cholinergic receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Anti M2 cholinergic receptor antibodies ELISA kit
E09A0812-96 BlueGene 1 plate of 96 wells 822 EUR
Description: A competitive ELISA for quantitative measurement of Monkey Anti M2 cholinergic receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Anti M2 cholinergic receptor antibodies ELISA kit
E04A0812-192T BlueGene 192 tests 1524 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit Anti M2 cholinergic receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Anti M2 cholinergic receptor antibodies ELISA kit
E04A0812-48 BlueGene 1 plate of 48 wells 624 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit Anti M2 cholinergic receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Anti M2 cholinergic receptor antibodies ELISA kit
E04A0812-96 BlueGene 1 plate of 96 wells 822 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit Anti M2 cholinergic receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Anti M2 cholinergic receptor antibodies ELISA kit
E01A26607 BlueGene 96T 700 EUR
Description: ELISA

Bovine Anti M2 cholinergic receptor antibodies ELISA kit
E01A78903 BlueGene 96T 700 EUR
Description: ELISA

Canine Anti M2 cholinergic receptor antibodies ELISA kit
E01A61474 BlueGene 96T 700 EUR
Description: ELISA

Monkey Anti M2 cholinergic receptor antibodies ELISA kit
E01A70186 BlueGene 96T 700 EUR
Description: ELISA

Chicken Anti M2 cholinergic receptor antibodies ELISA kit
E01A87629 BlueGene 96T 700 EUR
Description: ELISA

Porcine Anti M2 cholinergic receptor antibodies ELISA kit
E01A52756 BlueGene 96T 700 EUR
Description: ELISA

Rat Anti β 1 Adrenergic Receptor antibodies ELISA kit
E02A0813-192T BlueGene 192 tests 1524 EUR
Description: A competitive ELISA for quantitative measurement of Rat Anti β 1 Adrenergic Receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Anti β 1 Adrenergic Receptor antibodies ELISA kit
E02A0813-48 BlueGene 1 plate of 48 wells 624 EUR
Description: A competitive ELISA for quantitative measurement of Rat Anti β 1 Adrenergic Receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Anti β 1 Adrenergic Receptor antibodies ELISA kit
E02A0813-96 BlueGene 1 plate of 96 wells 822 EUR
Description: A competitive ELISA for quantitative measurement of Rat Anti β 1 Adrenergic Receptor antibodies in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.